1Y19 - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:11
 aligned with PI51C_MOUSE | O70161 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:11
                                   650 
          PI51C_MOUSE   641 SWVYSPLHYSA 651
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .eee.hhhh.. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 1y19 A 641 SWVYSPLHYSA 651
                                   650

Chain B from PDB  Type:PROTEIN  Length:192
 aligned with TLN1_MOUSE | P26039 from UniProtKB/Swiss-Prot  Length:2541

    Alignment length:192
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398  
           TLN1_MOUSE   209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
               SCOP domains d1y19b1 B:209-308 Talin-1                                                                           d1y19b2 B:309-400 Talin-1                                                                    SCOP domains
               CATH domains 1y19B01 B:209-306  [code=1.20.80.10, no name defined]                                             -1y19B02 B:308-400 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh......eeeeeee........eeeeeee...eeeee......eeeeee.hhh.eeeee..eeeee........eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------FERM_2  PDB: B:283-312        ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y19 B 209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398

Chain C from PDB  Type:PROTEIN  Length:11
 aligned with PI51C_MOUSE | O70161 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:11
                                   650 
          PI51C_MOUSE   641 SWVYSPLHYSA 651
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .eee.hhhh.. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 1y19 C 641 SWVYSPLHYSA 651
                                   650

Chain D from PDB  Type:PROTEIN  Length:192
 aligned with TLN1_MOUSE | P26039 from UniProtKB/Swiss-Prot  Length:2541

    Alignment length:192
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398  
           TLN1_MOUSE   209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
               SCOP domains d1y19d1 D:209-308 Talin-1                                                                           d1y19d2 D:309-400 Talin-1                                                                    SCOP domains
               CATH domains 1y19D01 D:209-306  [code=1.20.80.10, no name defined]                                             -1y19D02 D:308-400 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....eeeeeeee......eeeeeeeee..eeeeee.....eeeeee.hhh.eeeee..eeeee........eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------FERM_2  PDB: D:283-312        ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y19 D 209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398

Chain E from PDB  Type:PROTEIN  Length:11
 aligned with PI51C_MOUSE | O70161 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:11
                                   650 
          PI51C_MOUSE   641 SWVYSPLHYSA 651
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ..ee.hhhh.. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 1y19 E 641 SWVYSPLHYSA 651
                                   650

Chain F from PDB  Type:PROTEIN  Length:192
 aligned with TLN1_MOUSE | P26039 from UniProtKB/Swiss-Prot  Length:2541

    Alignment length:192
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398  
           TLN1_MOUSE   209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
               SCOP domains d1y19f1 F:209-308 Talin-1                                                                           d1y19f2 F:309-400 Talin-1                                                                    SCOP domains
               CATH domains 1y19F01 F:209-306  [code=1.20.80.10, no name defined]                                             -1y19F02 F:308-400 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.....eeeeeee........eeeeeeee..eeeeee.....eeeeee.hhh.eeeee..eeeee........eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------FERM_2  PDB: F:283-312        ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y19 F 209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398

Chain G from PDB  Type:PROTEIN  Length:11
 aligned with PI51C_MOUSE | O70161 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:11
                                   650 
          PI51C_MOUSE   641 SWVYSPLHYSA 651
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .eee.hhhh.. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 1y19 G 641 SWVYSPLHYSA 651
                                   650

Chain H from PDB  Type:PROTEIN  Length:192
 aligned with TLN1_MOUSE | P26039 from UniProtKB/Swiss-Prot  Length:2541

    Alignment length:192
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398  
           TLN1_MOUSE   209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
               SCOP domains d1y19h1 H:209-308 Talin-1                                                                           d1y19h2 H:309-400 Talin-1                                                                    SCOP domains
               CATH domains 1y19H01 H:209-306  [code=1.20.80.10, no name defined]                                             -1y19H02 H:308-400 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh......eeeeeee........eeeeeee...eeeee......eeeeee.hhh.eeeee..eeeee........eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------FERM_2  PDB: H:283-312        ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y19 H 209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398

Chain I from PDB  Type:PROTEIN  Length:11
 aligned with PI51C_MOUSE | O70161 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:11
                                   650 
          PI51C_MOUSE   641 SWVYSPLHYSA 651
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ..ee.hhhh.. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 1y19 I 641 SWVYSPLHYSA 651
                                   650

Chain J from PDB  Type:PROTEIN  Length:192
 aligned with TLN1_MOUSE | P26039 from UniProtKB/Swiss-Prot  Length:2541

    Alignment length:192
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398  
           TLN1_MOUSE   209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
               SCOP domains d1y19j1 J:209-308 Talin-1                                                                           d1y19j2 J:309-400 Talin-1                                                                    SCOP domains
               CATH domains 1y19J01 J:209-306  [code=1.20.80.10, no name defined]                                             -1y19J02 J:308-400 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.....eeeeeee........eeeeeee...eeeeee.....eeeeee.hhh.eeeee..eeeee........eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------FERM_2  PDB: J:283-312        ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y19 J 209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398

Chain K from PDB  Type:PROTEIN  Length:11
 aligned with PI51C_MOUSE | O70161 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:11
                                   650 
          PI51C_MOUSE   641 SWVYSPLHYSA 651
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ..ee.hhhh.. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 1y19 K 641 SWVYSPLHYSA 651
                                   650

Chain L from PDB  Type:PROTEIN  Length:192
 aligned with TLN1_MOUSE | P26039 from UniProtKB/Swiss-Prot  Length:2541

    Alignment length:192
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398  
           TLN1_MOUSE   209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
               SCOP domains d1y19l1 L:209-308 Talin-1                                                                           d1y19l2 L:309-400 Talin-1                                                                    SCOP domains
               CATH domains 1y19L01 L:209-306  [code=1.20.80.10, no name defined]                                             -1y19L02 L:308-400 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains
           Pfam domains (1) FERM_M-1y19L01 L:209-313                                                                                 --------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) FERM_M-1y19L02 L:209-313                                                                                 --------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) FERM_M-1y19L03 L:209-313                                                                                 --------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) FERM_M-1y19L04 L:209-313                                                                                 --------------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) FERM_M-1y19L05 L:209-313                                                                                 --------------------------------------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) FERM_M-1y19L06 L:209-313                                                                                 --------------------------------------------------------------------------------------- Pfam domains (6)
           Pfam domains (7) -----------------------------------------------------------------------------------------------------IRS-1y19L07 L:310-400                                                                       Pfam domains (7)
           Pfam domains (8) -----------------------------------------------------------------------------------------------------IRS-1y19L08 L:310-400                                                                       Pfam domains (8)
           Pfam domains (9) -----------------------------------------------------------------------------------------------------IRS-1y19L09 L:310-400                                                                       Pfam domains (9)
          Pfam domains (10) -----------------------------------------------------------------------------------------------------IRS-1y19L10 L:310-400                                                                       Pfam domains (10)
          Pfam domains (11) -----------------------------------------------------------------------------------------------------IRS-1y19L11 L:310-400                                                                       Pfam domains (11)
          Pfam domains (12) -----------------------------------------------------------------------------------------------------IRS-1y19L12 L:310-400                                                                       Pfam domains (12)
         Sec.struct. author hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.....eeeeeee........eeeeeee...eeeee......eeeeee.hhh.eee....eeeee........eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------FERM_2  PDB: L:283-312        ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y19 L 209 PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL 400
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,C,E,G,I,K (PI51C_MOUSE | O70161)

molecular function
	GO:0016308	1-phosphatidylinositol-4-phosphate 5-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4-phosphate + ATP = 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ADP + 2 H(+).
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016307	phosphatidylinositol phosphate kinase activity	Catalysis of the reaction: ATP + a phosphatidylinositol phosphate = ADP + a phosphatidylinositol bisphosphate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:1990147	talin binding	Interacting selectively and non-covalently with a talin, a family of related cytoskeletal proteins that play a role in assembly of actin filaments and migration of various cell types.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0007409	axonogenesis	De novo generation of a long process of a neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells. Refers to the morphogenesis or creation of shape or form of the developing axon.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0007016	cytoskeletal anchoring at plasma membrane	A cytoskeleton organization process that directly or indirectly links cytoskeletal filaments to the plasma membrane.
	GO:0006897	endocytosis	A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
	GO:0006887	exocytosis	A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
	GO:0006909	phagocytosis	An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
	GO:0006661	phosphatidylinositol biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0046488	phosphatidylinositol metabolic process	The chemical reactions and pathways involving phosphatidylinositol, any glycophospholipid in which a sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
cellular component
	GO:0005912	adherens junction	A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0012505	endomembrane system	A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0001891	phagocytic cup	An invagination of the cell membrane formed by an actin dependent process during phagocytosis. Following internalization it is converted into a phagosome.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.
	GO:0001931	uropod	A membrane projection with related cytoskeletal components at the trailing edge of a cell in the process of migrating or being activated, found on the opposite side of the cell from the leading edge or immunological synapse, respectively.

Chain B,D,F,H,J,L (TLN1_MOUSE | P26039)

molecular function
	GO:0030274	LIM domain binding	Interacting selectively and non-covalently with a LIM domain (for Lin-11 Isl-1 Mec-3) of a protein, a domain with seven conserved cysteine residues and a histidine, that binds two zinc ions and acts as an interface for protein-protein interactions.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
	GO:0017166	vinculin binding	Interacting selectively and non-covalently with vinculin, a protein found in muscle, fibroblasts, and epithelial cells that binds actin and appears to mediate attachment of actin filaments to integral proteins of the plasma membrane.
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007044	cell-substrate junction assembly	The aggregation, arrangement and bonding together of a set of components to form a junction between a cell and its substrate.
	GO:0030866	cortical actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of actin-based cytoskeletal structures in the cell cortex, i.e. just beneath the plasma membrane.
	GO:0007016	cytoskeletal anchoring at plasma membrane	A cytoskeleton organization process that directly or indirectly links cytoskeletal filaments to the plasma membrane.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 12)

CATH Domains (2, 12)

Pfam Domains (2, 12)

Gene Ontology (46, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File