1XVY - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF IRON-FREE SERRATIA MARCESCENS SFUA

Authors :   S. R. Shouldice, D. E. Mcree, D. R. Dougan, L. W. Tari, A. B. Schryvers

Date :   28 Oct 04 (Deposition) - 14 Dec 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.74

Chains :   Asym./Biol. Unit : A

Keywords :   Periplasmic Iron Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. R. Shouldice, D. E. Mcree, D. R. Dougan, L. W. Tari, A. B. Schryvers
Novel Anion-Independent Iron Coordination By Members Of A Third Class Of Bacterial Periplasmic Ferric Ion-Binding Proteins
J. Biol. Chem. V. 280 5820 2005
PubMed-ID: 15576371 | Reference-DOI: 10.1074/JBC.M411238200
(for further references see the PDB file header)

Molecule 1 - SFUA
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PT7-7
	Expression System Strain	:	BL21(DE3)/PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SFUA
	Organism Scientific	:	YERSINIA ENTEROCOLITICA
	Organism Taxid	:	630

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 1)

No.	Name	Count	Type	Full Name
1	CIT	1	Ligand/Ion	CITRIC ACID

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:11 , GLU A:59 , SER A:176 , TYR A:196 , HOH A:583 , HOH A:624 , HOH A:719 , HOH A:788 , HOH A:811 , HOH A:884	BINDING SITE FOR RESIDUE CIT A 510

(no "SS Bond" information available for 1XVY)

(no "Cis Peptide Bond" information available for 1XVY)

(no "SAP(SNP)/Variant" information available for 1XVY)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SBP_BACTERIAL_1	PS01037	Bacterial extracellular solute-binding proteins, family 1 signature.	FBPA_SERMA	126-143	1	A:97-114

(no "Exon" information available for 1XVY)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:307
 aligned with FBPA_SERMA | P21408 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:307
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           FBPA_SERMA    32 GIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARSTVFVYNPAKLSDAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLAWLKAMKTNFTAYKGNSTVMKAVNAGQVDSGVIYHYYPFVDGAKTGENSNNIKLYYFKHQDPGAFVSISGGGVLASSKHQQQAQAFIKWITGKQGQEILRTNNAFEYAVGVGAASNPKLVPLKDLDAPKVDAAQLNSKKVVELMTEAGLL 338
               SCOP domains d1xvya_ A: Ferric-binding protein FbpA                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1xvyA01 A:3-98,A:225-279 Periplasmic binding protein-like II                                    1xvyA02 A:99-224,A:280-309 Periplasmic binding protein-like II                                                                1xvyA01 A:3-98,A:225-279                               1xvyA02 A:99-224,A:280-309     CATH domains
               Pfam domains -----SBP_bac_1-1xvyA01 A:8-256                                                                                                                                                                                                                                ----------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhh...eee...hhhhhhhhhh......hhhhhhhhhhhhh......eeeeeeeeeeee.....hhhhh..hhhhhhhhhhh..eee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhheee..hhhhhhhhhhh....eeeeehhhhhhhhhh........eee.....hhhh.eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhh....hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------SBP_BACTERIAL_1   --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xvy A   3 GIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARSTVFVYNPAKLSDAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLAWLKAMKTNFTAYKGNSTVMKAVNAGQVDSGVIYHYYPFVDGAKTGENSNNIKLYYFKHQDPGAFVSISGGGVLASSKHQQQAQAFIKWITGKQGQEILRTNNAFEYAVGVGAASNPKLVPLKDLDAPKVDAAQLNSKKVVELMTEAGLL 309
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Periplasmic binding protein-like II (813)

Superfamily: Periplasmic binding protein-like II (813)

Family: Phosphate binding protein-like (463)

Protein domain: Ferric-binding protein FbpA (25)

Serratia marcescens, SfuA [TaxId: 615] (1)

d1xvya_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: D-Maltodextrin-Binding Protein; domain 2 (600)

Homologous Superfamily: Periplasmic binding protein-like II (486)

Yersinia enterocolitica. Organism_taxid: 630. (2)

1a	1xvyA01	A:3-98,A:225-279
1b	1xvyA02	A:99-224,A:280-309

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PBP (391)

Family: SBP_bac_1 (83)

Serratia marcescens (1)

SBP_bac_1-1xvyA01

A:8-256

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (FBPA_SERMA | P21408)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055072	iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xvy)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1xvy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FBPA_SERMA \| P21408
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FBPA_SERMA \| P21408
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1XVY)

1xvx	IRON-LOADED YERSINIA ENTEROCOLITICA YFUA

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 2)

Pfam Domains (1, 1)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File