![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 7) Biological Unit 1 (3, 7) |
Asymmetric Unit (7, 7)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1XT3) |
(no "SAP(SNP)/Variant" information available for 1XT3) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1XT3) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:60 aligned with 3SA3_NAJAT | P60301 from UniProtKB/Swiss-Prot Length:81 Alignment length:60 31 41 51 61 71 81 3SA3_NAJAT 22 LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN 81 SCOP domains d1xt3a_ A: Cardiotoxin III SCOP domains CATH domains 1xt3A00 A:1-60 CD59 CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------SNAKE_TOXIN --- PROSITE Transcript ------------------------------------------------------------ Transcript 1xt3 A 1 LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN 60 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:60 aligned with 3SA3_NAJAT | P60301 from UniProtKB/Swiss-Prot Length:81 Alignment length:60 31 41 51 61 71 81 3SA3_NAJAT 22 LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN 81 SCOP domains d1xt3b_ B: Cardiotoxin III SCOP domains CATH domains 1xt3B00 B:1-60 CD59 CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------SNAKE_TOXIN --- PROSITE Transcript ------------------------------------------------------------ Transcript 1xt3 B 1 LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN 60 10 20 30 40 50 60
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1XT3) |
Asymmetric Unit(hide GO term definitions) Chain A,B (3SA3_NAJAT | P60301)
|
|
|
|
|
|
|