Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THERMOTOGA MARITIMA CHEX
 
Authors :  S. Y. Park, X. Chao, G. Gonzalez-Bonet, B. D. Beel, A. M. Bilwes, B. R. Crane
Date :  29 Sep 04  (Deposition) - 07 Dec 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.48
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Chemotaxis, Signal Transduction, Protein Phosphatase, Attractant (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Y. Park, X. Chao, G. Gonzalez-Bonet, B. D. Beel, A. M. Bilwes, B. R. Crane
Structure And Function Of An Unusual Family Of Protein Phosphatases; The Bacterial Chemotaxis Proteins Chec And Chex.
Mol. Cell V. 16 563 2004
PubMed-ID: 15546616  |  Reference-DOI: 10.1016/J.MOLCEL.2004.10.018
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHEMOTAXIS PROTEIN CHEX
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28A+
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XKO)

(-) Sites  (0, 0)

(no "Site" information available for 1XKO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XKO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XKO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XKO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XKO)

(-) Exons   (0, 0)

(no "Exon" information available for 1XKO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:150
 aligned with CHEX_THEMA | Q9X1V3 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:153
                             1                                                                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149   
           CHEX_THEMA     - -MDARIVNALIGSVYETIRDVLGIEPKTGKPSTVSHIEIPHSLVTVIGITGGIEGSLIYSFSSETALKVVSAMMGGMEYNQLDELALSAIGELGNMTAGKLAMKLEHLGKHVDITPPTVVSGRDLKIKSFGVILKLPISVFSEEDFDLHLSVK 152
               SCOP domains d1xkoa_ A: Chemotaxis protein CheX                                                                                                                        SCOP domains
               CATH domains 1xkoA00 A:0-152 Chemotaxis protein chec                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhh....ee...eee........eeeeeeeee...eeeeeeehhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh..---.eee...eeee....eeee...eeeeeee......eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xko A   0 MMDARIVNALIGSVYETIRDVLGIEPKTGKPSTVSHIEIPHSLVTVIGITGGIEGSLIYSFSSETALKVVSAMMGGMEYNQLDELALSAIGELGNMTAGKLAMKLEH---HVDITPPTVVSGRDLKIKSFGVILKLPISVFSEEDFDLHLSVK 152
                                     9        19        29        39        49        59        69        79        89        99      |  -|      119       129       139       149   
                                                                                                                                    106 110                                          


Chain B from PDB  Type:PROTEIN  Length:159
 aligned with CHEX_THEMA | Q9X1V3 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:159
                                1                                                                                                                                                          
                                |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146         
           CHEX_THEMA     - ----MDARIVNALIGSVYETIRDVLGIEPKTGKPSTVSHIEIPHSLVTVIGITGGIEGSLIYSFSSETALKVVSAMMGGMEYNQLDELALSAIGELGNMTAGKLAMKLEHLGKHVDITPPTVVSGRDLKIKSFGVILKLPISVFSEEDFDLHLSVKSGG 155
               SCOP domains d1xkob_ B: Chemotaxis protein CheX                                                                                                                              SCOP domains
               CATH domains 1xkoB00 B:-3-155 Chemotaxis protein chec                                                                                                                        CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------CheC-1xkoB01 B:84-120                ----------------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------CheC-1xkoB02 B:84-120                ----------------------------------- Pfam domains (2)
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhh...ee...eee........eeeeeeeee..eeeeeeeehhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh.....eee...eeee....eee...eeeeeeee......eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xko B  -3 GSHMMDARIVNALIGSVYETIRDVLGIEPKTGKPSTVSHIEIPHSLVTVIGITGGIEGSLIYSFSSETALKVVSAMMGGMEYNQLDELALSAIGELGNMTAGKLAMKLEHLGKHVDITPPTVVSGRDLKIKSFGVILKLPISVFSEEDFDLHLSVKSGG 155
                                     6        16        26        36        46        56        66        76        86        96       106       116       126       136       146
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: CheC-like (4)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CHEX_THEMA | Q9X1V3)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0006935    chemotaxis    The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xko)
 
  Sites
(no "Sites" information available for 1xko)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xko)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xko
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CHEX_THEMA | Q9X1V3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CHEX_THEMA | Q9X1V3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CHEX_THEMA | Q9X1V3: 1squ

(-) Related Entries Specified in the PDB File

1squ