1XKI - JenaLib

Title :   CRYSTAL STRUCTURE OF HUMAN TEAR LIPOCALIN/VON EBNERS GLAND PROTEIN

Authors :   D. A. Breustedt, I. P. Korndoerfer, B. Redl, A. Skerra

Date :   29 Sep 04 (Deposition) - 19 Oct 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Beta Barrel, Ligand Binding Protein, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. A. Breustedt, I. P. Korndoerfer, B. Redl, A. Skerra
The 1. 8-A Crystal Structure Of Human Tear Lipocalin Reveals An Extended Branched Cavity With Capacity For Multiple Ligands
J. Biol. Chem. V. 280 484 2005
PubMed-ID: 15489503 | Reference-DOI: 10.1074/JBC.M410466200
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (5, 5)

Asymmetric/Biological Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000371781	1b	ENSE00001456083	chr9:138413301-138413433	133	LCN1_HUMAN	1-30	30	1	A:12-12	1
1.2	ENST00000371781	2	ENSE00001791131	chr9:138413893-138414023	131	LCN1_HUMAN	31-74	44	1	A:13-55 (gaps)	43
1.3	ENST00000371781	3	ENSE00000828356	chr9:138415078-138415148	71	LCN1_HUMAN	74-98	25	1	A:58-80	23
1.4	ENST00000371781	4	ENSE00000828355	chr9:138415726-138415836	111	LCN1_HUMAN	98-135	38	1	A:80-117 (gaps)	38
1.5	ENST00000371781	5	ENSE00001708103	chr9:138416676-138416777	102	LCN1_HUMAN	135-169	35	1	A:117-150	34
1.6	ENST00000371781	6	ENSE00000828353	chr9:138416978-138417004	27	LCN1_HUMAN	169-176	8	0	-	-
1.7a	ENST00000371781	7a	ENSE00001347956	chr9:138418190-138418378	189	LCN1_HUMAN	-	0	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:128
 aligned with LCN1_HUMAN | P31025 from UniProtKB/Swiss-Prot  Length:176

    Alignment length:139
                                    39        49        59        69        79        89        99       109       119       129       139       149       159         
           LCN1_HUMAN    30 DVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQS 168
               SCOP domains d1xkia_ A: Vo       n Ebner's gland protein   (VEGP, tear lipocalin)                                                                        SCOP domains
               CATH domains 1xkiA00 A:12-       150  [code=2.40.128.20,   no name defined]                                                                              CATH domains
               Pfam domains --Lipocalin-1       xkiA01 A:14-150                                                                                                         Pfam domains
         Sec.struct. author ...eeeeeeeeee-------.......eeeee.....eeeeeee--....eeeeeeeee.....eeeehhhheeeeeee.....eeeeeeee.--...eeeeeeee........hhhhhhhhhhhh.....eee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1Exon 1.2  PDB: A:13-55 (gaps) UniProt: 31-74-----------------------Exon 1.4  PDB: A:80-117 (gaps)        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.3  PDB: A:58-80   ------------------------------------Exon 1.5  PDB: A:117-150           Transcript 1 (2)
                 1xki A  12 DVSGTWYLKAMTV-------NLESVTPMTLTTLEGGNLEAKVTM--SGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGE--GKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQS 150
                                    21  |      -|       41        51   |  | 61        71        81        91       101  |  | 111       121       131       141         
                                       24      32                     55 58                                           104  |                                           
                                                                                                                         107

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (LCN1_HUMAN | P31025)

molecular function
	GO:0004869	cysteine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of a cysteine-type endopeptidase, any enzyme that hydrolyzes peptide bonds in polypeptides by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
biological process
	GO:0015909	long-chain fatty acid transport	The directed movement of long-chain fatty acids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. A long-chain fatty acid is a fatty acid with a chain length between C13 and C22.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0050896	response to stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
	GO:0001895	retina homeostasis	A tissue homeostatic process involved in the maintenance of an internal equilibrium within the retina of the eye, including control of cellular proliferation and death and control of metabolic function.
	GO:0050909	sensory perception of taste	The series of events required for an organism to receive a gustatory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Gustation involves the direct detection of chemical composition, usually through contact with chemoreceptor cells. This is a neurological process.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Thr A:37 - Pro A:38	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1xki
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LCN1_HUMAN \| P31025
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description