|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (0, 0)| (no "Site" information available for 1XJC) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1XJC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XJC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XJC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XJC) |
Exons (0, 0)| (no "Exon" information available for 1XJC) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:145 aligned with D0VWV1_GEOSE | D0VWV1 from UniProtKB/TrEMBL Length:169 Alignment length:165 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 D0VWV1_GEOSE 4 MNVWQVVGYKHSGKTTLMEKWVAAAVREGWRVGTVKHHGHGGEPARPEGVDSVRHERAGAVATAVEGDGLLQLHLRRPLWRLDDVLALYAPLRLDLVLVEGYKQERHPKVVLVRSEEDWASLQHLANIRAVIAWEPLEGPLAHPVFSLADDDEYIPWLMNEVRTR 168 SCOP domains d1xjca_ A: Molybdopterin-guanine dinuc leotide biosynthesis protein MobB SCOP domains CATH domains -1xjcA00 A:2-165 P-loop containing nuc leotide triphosphate hydrolases CATH domains Pfam domains -MobB-1xjcA01 A:2-136 ----------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1xjc A 1 mNVWQVVGYKHSGKTTLmEKWVAAAVREGWRVGTVKHH--------------------GAVATAVEGDGLLQLHLRRPLWRLDDVLALYAPLRLDLVLVEGYKQERHPKVVLVRSEEDWASLQHLANIRAVIAWEPLEGPLAHPVFSLADDDEYIPWLmNEVRTR 165 | 10 |20 30 | - - 60 70 80 90 100 110 120 130 140 150 160 | 18-MSE 38 59 159-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (D0VWV1_GEOSE | D0VWV1)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|