Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  1.8A CRSYTAL STRUCUTRE OF FORMIMINOGLUTAMASE FROM VIBRIO CHOLERAE O1 BIOVAR ELTOR STR. N16961
 
Authors :  R. Wu, R. Zhang, C. Shonda, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  14 Sep 04  (Deposition) - 26 Oct 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Formiminoglutamase Protein, Vibrio Cholerae O1 Biovar Eltor, Structure Genomics, Protein Structure Initiative, Mcsg, The Midwest Center For Structural Genomics, Psi, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Wu, R. Zhang, C. Shonda, A. Joachimiak
1. 8A Crystal Structure Of Formiminoglutamas From Vibrio Cholerae O1 Biovar Eltor Str. N16961
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FORMIMIDOYLGLUTAMASE
    Chains: A
    EC Number: 3.5.3.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PDM68
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: HUTG
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666
    Synonym: FORMIMINOGLUTAMASE, FORMIMINOGLUTAMATE HYDROLASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XFK)

(-) Sites  (0, 0)

(no "Site" information available for 1XFK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XFK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XFK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XFK)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARGINASE_2PS51409 Arginase family profile.HUTG_VIBCH37-334  1A:37-333
2ARGINASE_1PS01053 Arginase family signature.HUTG_VIBCH252-273  1A:252-273

(-) Exons   (0, 0)

(no "Exon" information available for 1XFK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:324
 aligned with HUTG_VIBCH | Q9KSQ2 from UniProtKB/Swiss-Prot  Length:336

    Alignment length:324
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329    
           HUTG_VIBCH    10 TWQGRHDPEDGQAGRRVHHIACPIQVGELANQEPGVALIGFECDAGVERNKGRTGAKHAPSLIKQALANLAWHHPIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHARAIVLGGGHEIAWATFQGLAQHFLATGVKQPRIGIINFDAHFDLRTFESELAPVRPSSGTPFNQIHHFCQQQGWDFHYACLGVSRASNTPALFERADKLGVWYVEDKAFSPLSLKDHLTQLQHFIDDCDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKNKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQSI 333
               SCOP domains d1xfka_ A: Formimidoylglutamase HutG                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1xfkA00 A:10-333  [code=3.40.800.10, no name defined]                                                                                                                                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------Arginase-1xfkA01 A:43-325                                                                                                                                                                                                                                                                  -------- Pfam domains
         Sec.struct. author ......hhhhhhhh.hhhhheee.hhhhhhhh...eeeeeee.hhhhhhh....hhhhhhhhhhhhhhh........eeeeeeee....hhhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhhhhhh......eeeeee.....................hhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhh..eeee.hhh...hhhhhhhhhhhhhhh..eeeeeee.hhh................hhhhhhhhhhhhhhh...eeeeeee..hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------------------ARGINASE_2  PDB: A:37-333 UniProt: 37-334                                                                                                                                                                                                                                                                 PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ARGINASE_1            ------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1xfk A  10 TWQGRHDPEDGQAGRRVHHIACPIQVGELANQEPGVALIGFECDAGVERNKGRTGAKHAPSLIKQALANLAWHHPIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHARAIVLGGGHEIAWATFQGLAQHFLATGVKQPRIGIINFDAHFDLRTFESELAPVRPSSGTPFNQIHHFCQQQGWDFHYACLGVSRASNTPALFERADKLGVWYVEDKAFSPLSLKDHLTQLQHFIDDCDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKNKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQSI 333
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Arginase (56)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (HUTG_VIBCH | Q9KSQ2)
molecular function
    GO:0050415    formimidoylglutamase activity    Catalysis of the reaction: N-formimidoyl-L-glutamate + H(2)O = L-glutamate + formamide.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016813    hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines    Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amidine, a compound of the form R-C(=NH)-NH2.
    GO:0030145    manganese ion binding    Interacting selectively and non-covalently with manganese (Mn) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0006548    histidine catabolic process    The chemical reactions and pathways resulting in the breakdown of histidine, 2-amino-3-(1H-imidazol-4-yl)propanoic acid.
    GO:0019556    histidine catabolic process to glutamate and formamide    The chemical reactions and pathways resulting in the breakdown of histidine into other compounds, including glutamate and formamide.
    GO:0019557    histidine catabolic process to glutamate and formate    The chemical reactions and pathways resulting in the breakdown of histidine into other compounds, including glutamate and formate.
    GO:0006547    histidine metabolic process    The chemical reactions and pathways involving histidine, 2-amino-3-(1H-imidazol-4-yl)propanoic acid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xfk)
 
  Sites
(no "Sites" information available for 1xfk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xfk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xfk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HUTG_VIBCH | Q9KSQ2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.3.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HUTG_VIBCH | Q9KSQ2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XFK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XFK)