|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (2, 3) Biological Unit 2 (2, 6) Biological Unit 3 (2, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XE1) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XE1) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XE1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XE1) |
Exons (0, 0)| (no "Exon" information available for 1XE1) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:91 aligned with Q8U2D2_PYRFU | Q8U2D2 from UniProtKB/TrEMBL Length:108 Alignment length:91 27 37 47 57 67 77 87 97 107 Q8U2D2_PYRFU 18 IEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT 108 SCOP domains d1xe1a_ A: Hypothetical protein PF0907 SCOP domains CATH domains 1xe1A00 A:18-108 Translation factors CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 1xe1 A 18 IEILSKKPAGKVVVEEVVNImGKDVIIGTVESGmIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT 108 27 37| 47 | 57 67 77 87 97 107 38-MSE 51-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1XE1) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1XE1)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|