![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1X9R) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 4)
|
(no "Exon" information available for 1X9R) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:105 aligned with UMEC_ARMRU | P42849 from UniProtKB/Swiss-Prot Length:115 Alignment length:105 1 | 9 19 29 39 49 59 69 79 89 99 UMEC_ARMRU - -EDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGA 104 SCOP domains d1x9ra_ A: automated matches SCOP domains CATH domains 1x9rA00 A:0-104 Cupredoxins - blue copper proteins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------I-------------------------------------------------------- SAPs(SNPs) PROSITE (1) -PHYTOCYANIN PDB: A:1-103 UniProt: 1-103 - PROSITE (1) PROSITE (2) -------------------------------------------------------------------------------COPPER_BLUE --------- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------- Transcript 1x9r A 0 MEDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGA 104 9 19 29 39 49 59 69 79 89 99 Chain B from PDB Type:PROTEIN Length:104 aligned with UMEC_ARMRU | P42849 from UniProtKB/Swiss-Prot Length:115 Alignment length:104 1 | 9 19 29 39 49 59 69 79 89 99 UMEC_ARMRU - -EDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVG 103 SCOP domains d1x9rb_ B: automated matches SCOP domains CATH domains 1x9rB00 B:0-103 Cupredoxins - blue copper proteins CATH domains Pfam domains (1) -----------Cu_bind_like-1x9rB01 B:11-95 -------- Pfam domains (1) Pfam domains (2) -----------Cu_bind_like-1x9rB02 B:11-95 -------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------I------------------------------------------------------- SAPs(SNPs) PROSITE (1) -PHYTOCYANIN PDB: B:1-103 UniProt: 1-103 PROSITE (1) PROSITE (2) -------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------- Transcript 1x9r B 0 MEDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVG 103 9 19 29 39 49 59 69 79 89 99
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit(hide GO term definitions) Chain A,B (UMEC_ARMRU | P42849)
|
|
|
|
|
|
|