Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A HYPOTHETICAL PROTEIN
 
Authors :  J. Seetharaman, S. Swaminathan, S. K. Burley, New York Sgx Research For Structural Genomics (Nysgxrc)
Date :  19 Aug 04  (Deposition) - 14 Sep 04  (Release) - 09 Feb 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Keywords :  Hypothetical Protein, Vibrio Cholerae, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Seetharaman, K. R. Rajashankar, V. Solorzano, R. Kniewel, C. D. Lima, J. B. Bonanno, S. K. Burley, S. Swaminathan
Crystal Structures Of Two Putative Phosphoheptose Isomerases.
Proteins V. 63 1092 2006
PubMed-ID: 16477602  |  Reference-DOI: 10.1002/PROT.20908

(-) Compounds

Molecule 1 - PUTATIVE PHOSPHOHEPTOSE ISOMERASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: LPCA, GMHA
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): AB
Biological Unit 2 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1X94)

(-) Sites  (0, 0)

(no "Site" information available for 1X94)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1X94)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1X94)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1X94)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.GMHA_VIBCH37-191
 		  2A:37-191
B:37-191
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.GMHA_VIBCH37-191
 		  2A:37-191
B:37-191
Biological Unit 2 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.GMHA_VIBCH37-191
 		  4A:37-191
B:37-191

(-) Exons   (0, 0)

(no "Exon" information available for 1X94)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:176
 aligned with GMHA_VIBCH | Q9KPY2 from UniProtKB/Swiss-Prot  Length:191

    Alignment length:191
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190 
           GMHA_VIBCH     1 MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAISDPSHLSCVSNDFGYDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA 191
               SCOP domains d1x94a_ A: Phosphoheptose isomerase GmhA1                                                                                                                                                       SCOP domains
               CATH domains 1x94A00 A:1-191 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee...hhhhhhhhhhhhhhhhhh.......eee.---------------.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhh.eeeeeee..hhhhh....eeeee....hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------SIS  PDB: A:37-191 UniProt: 37-191                                                                                                                          PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x94 A   1 MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAI---------------DYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA 191
                                    10        20        30        40        50        60        70        80 |       -       100       110       120       130       140       150       160       170       180       190 
                                                                                                            82              98                                                                                             


Chain B from PDB  Type:PROTEIN  Length:176
 aligned with GMHA_VIBCH | Q9KPY2 from UniProtKB/Swiss-Prot  Length:191

    Alignment length:191
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190 
           GMHA_VIBCH     1 MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAISDPSHLSCVSNDFGYDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA 191
               SCOP domains d1x94b_ B: Phosphoheptose isomerase GmhA1                                                                                                                                                       SCOP domains
               CATH domains 1x94B00 B:1-191 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                                            CATH domains
           Pfam domains (1) ---------SIS_2-1x94B01 B:10-146                                                                                                                   --------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------SIS_2-1x94B02 B:10-146                                                                                                                   --------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhh.......eee.---------------.hhhhhhhhhhh....eeeeee....hhhhhhhhhhhhh...eeeeee...hhhhh....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------SIS  PDB: B:37-191 UniProt: 37-191                                                                                                                          PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x94 B   1 MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAI---------------DYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA 191
                                    10        20        30        40        50        60        70        80 |       -       100       110       120       130       140       150       160       170       180       190 
                                                                                                            82              98
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: SIS (53)
(-)
Family: SIS_2 (6)
(-)
Vibrio cholerae (1)
1aSIS_2-1x94B01B:10-146
1bSIS_2-1x94B02B:10-146

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (GMHA_VIBCH | Q9KPY2)
molecular function
    GO:0008968    D-sedoheptulose 7-phosphate isomerase activity    Catalysis of the reaction: D-sedoheptulose-7-phosphate = D-alpha,beta-D-heptose 7-phosphate.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:2001061    D-glycero-D-manno-heptose 7-phosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of a D-glycero-D-manno-heptose 7-phosphate.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0009103    lipopolysaccharide biosynthetic process    The chemical reactions and pathways resulting in the formation of lipopolysaccharides, any of a group of related, structurally complex components of the outer membrane of Gram-negative bacteria.
    GO:0009244    lipopolysaccharide core region biosynthetic process    The chemical reactions and pathways resulting in the formation of the core region of bacterial lipopolysaccharides, which contains ten saccharide residues.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x94)
 
  Sites
(no "Sites" information available for 1x94)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x94)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1x94
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GMHA_VIBCH | Q9KPY2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GMHA_VIBCH | Q9KPY2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1X94)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1X94)