Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF PECTIN DEGRADING ENZYME 5-KETO 4-DEOXYURONATE ISOMERASE FROM ESCHERICHIA COLI
 
Authors :  A. A. Fedorov, E. V. Fedorov, S. C. Almo, S. K. Burley, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  18 Aug 04  (Deposition) - 21 Sep 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Keywords :  Structural Genomics, Protein Structure Initiative, 5-Keto 4- Deoxyuronate Isomerase, Nysgxrc Target T1827, Psi, New York Sgx Research Center For Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. A. Fedorov, E. V. Fedorov, S. C. Almo
The Crystal Structure Of Pectin Degrading Enzyme 5-Keto 4-Deoxyuronate Isomerase From Escherichia Coli
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 4-DEOXY-L-THREO-5-HEXOSULOSE-URONATE KETOL- ISOMERASE
    Chains: A, B, C, D, E, F
    EC Number: 5.3.1.17
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: KDUI
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: 5-KETO-4-DEOXYURONATE ISOMERASE, DKI ISOMERASE

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): A     
Biological Unit 2 (1x):  B    
Biological Unit 3 (1x):   C   
Biological Unit 4 (1x):    D  
Biological Unit 5 (1x):     E 
Biological Unit 6 (1x):      F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1X8M)

(-) Sites  (0, 0)

(no "Site" information available for 1X8M)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1X8M)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1X8M)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1X8M)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1X8M)

(-) Exons   (0, 0)

(no "Exon" information available for 1X8M)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:259
 aligned with KDUI_ECOLI | Q46938 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:267
                             1                                                                                                                                                                                                                                                                         
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       
          KDUI_ECOLI      - -MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF  266
               SCOP domains d1x8ma_ A: 5-keto-4-deoxyuronate isomerase KduI                                                                                                                                                                                                                             SCOP domains
               CATH domains 1x8mA01 1x8mA02               1x8mA01 A:1002-1009,A:1032-1145 pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1                1x8mA02 A:1010-1031,A:1146-1268 4-deoxy-l-threo-5        -hexosulose-uronate ketol- isomerase; domain 2                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhhhhhh.hhhhhhhhhee...........eee....eeeeee......eeehhhhhhhhh..hhhh.eeeeeee....eeeee..eeeee....eeee......eeeee........eeeeeee.......eee.......eee........eeeeeee..........eeeeeee........--------.eeeeeee.......eeeee......eeeee...eeeee.......eee....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1x8m A 1002 SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNT--------RMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF 1268
                                  1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191  |      - |    1211      1221      1231      1241      1251      1261       
                                                                                                                                                                                                                         1194     1203                                                                 


Chain B from PDB  Type:PROTEIN  Length:259
 aligned with KDUI_ECOLI | Q46938 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:267
                             1                                                                                                                                                                                                                                                                         
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       
          KDUI_ECOLI      - -MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF  266
               SCOP domains d1x8mb_ B: 5-keto-4-deoxyuronate isomerase KduI                                                                                                                                                                                                                             SCOP domains
               CATH domains 1x8mB01 1x8mB02               1x8mB01 B:2002-2009,B:2032-2145 pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1                1x8mB02 B:2010-2031,B:2146-2268 4-deoxy-l-threo-5        -hexosulose-uronate ketol- isomerase; domain 2                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhhhhhh.hhhhhhhhhee...........eee....eeeeee......eeehhhhhhhhh..hhhh.eeeeeee....eeeee..eeeee....eeee......eeeee........eeeeeee.......eee.......eee........eeeeeee..........eeeeeee........--------.eeeeeee......eeeeee......eeeeee..eeeee.......eee....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1x8m B 2002 SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNT--------RMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF 2268
                                  2011      2021      2031      2041      2051      2061      2071      2081      2091      2101      2111      2121      2131      2141      2151      2161      2171      2181      2191  |      - |    2211      2221      2231      2241      2251      2261       
                                                                                                                                                                                                                         2194     2203                                                                 


Chain C from PDB  Type:PROTEIN  Length:259
 aligned with KDUI_ECOLI | Q46938 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:267
                             1                                                                                                                                                                                                                                                                         
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       
          KDUI_ECOLI      - -MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF  266
               SCOP domains d1x8mc_ C: 5-keto-4-deoxyuronate isomerase KduI                                                                                                                                                                                                                             SCOP domains
               CATH domains 1x8mC01 1x8mC02               1x8mC01 C:3002-3009,C:3032-3145 pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1                1x8mC02 C:3010-3031,C:3146-3268 4-deoxy-l-threo-5        -hexosulose-uronate ketol- isomerase; domain 2                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhhhhhh.hhhhhhhhhee...........eee....eeeeee......eeehhhhhhhhh..hhhh.eeeeeee....eeeee..eeeee....eeee......eeeee........eeeeeee.......eee.......eee........eeeeeee..........eeeeeee........--------.eeeeeee.......eeeee......eeeee...eeeee.......eee....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1x8m C 3002 SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNT--------RMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF 3268
                                  3011      3021      3031      3041      3051      3061      3071      3081      3091      3101      3111      3121      3131      3141      3151      3161      3171      3181      3191  |      - |    3211      3221      3231      3241      3251      3261       
                                                                                                                                                                                                                         3194     3203                                                                 


Chain D from PDB  Type:PROTEIN  Length:259
 aligned with KDUI_ECOLI | Q46938 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:267
                             1                                                                                                                                                                                                                                                                         
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       
          KDUI_ECOLI      - -MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF  266
               SCOP domains d1x8md_ D: 5-keto-4-deoxyuronate isomerase KduI                                                                                                                                                                                                                             SCOP domains
               CATH domains 1x8mD01 1x8mD02               1x8mD01 D:4002-4009,D:4032-4145 pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1                1x8mD02 D:4010-4031,D:4146-4268 4-deoxy-l-threo-5        -hexosulose-uronate ketol- isomerase; domain 2                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhhhhhh.hhhhhhhhhee...........eee....eeeeee......eeehhhhhhhhh..hhhh.eeeeeee....eeeee..eeeee....eeee......eeeee........eeeeeee.......eee.......eee........eeeeeee..........eeeeeee........--------.eeeeeee.......eeeee......eeeee...eeeee.......eee....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1x8m D 4002 SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNT--------RMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF 4268
                                  4011      4021      4031      4041      4051      4061      4071      4081      4091      4101      4111      4121      4131      4141      4151      4161      4171      4181      4191  |      - |    4211      4221      4231      4241      4251      4261       
                                                                                                                                                                                                                         4194     4203                                                                 


Chain E from PDB  Type:PROTEIN  Length:259
 aligned with KDUI_ECOLI | Q46938 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:267
                             1                                                                                                                                                                                                                                                                         
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       
          KDUI_ECOLI      - -MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF  266
               SCOP domains d1x8me_ E: 5-keto-4-deoxyuronate isomerase KduI                                                                                                                                                                                                                             SCOP domains
               CATH domains 1x8mE01 1x8mE02               1x8mE01 E:5002-5009,E:5032-5145 pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1                1x8mE02 E:5010-5031,E:5146-5268 4-deoxy-l-threo-5        -hexosulose-uronate ketol- isomerase; domain 2                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhhhhhh.hhhhhhhhhee...........eee....eeeeee......eeehhhhhhhhh..hhhh.eeeeeee....eeeee..eeeee....eeee......eeeee........eeeeeee.......eee.......eee........eeeeeee..........eeeeeee........--------.eeeeeee.......eeeee......eeeee...eeeee.......eee....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1x8m E 5002 SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNT--------RMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF 5268
                                  5011      5021      5031      5041      5051      5061      5071      5081      5091      5101      5111      5121      5131      5141      5151      5161      5171      5181      5191  |      - |    5211      5221      5231      5241      5251      5261       
                                                                                                                                                                                                                         5194     5203                                                                 


Chain F from PDB  Type:PROTEIN  Length:259
 aligned with KDUI_ECOLI | Q46938 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:267
                             1                                                                                                                                                                                                                                                                         
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       
          KDUI_ECOLI      - -MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF  266
               SCOP domains d1x8mf_ F: 5-keto-4-deoxyuronate isomerase KduI                                                                                                                                                                                                                             SCOP domains
               CATH domains 1x8mF01 1x8mF02               1x8mF01 F:6002-6009,F:6032-6145 pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1                1x8mF02 F:6010-6031,F:6146-6268 4-deoxy-l-threo-5        -hexosulose-uronate ketol- isomerase; domain 2                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhhhhhh.hhhhhhhhhee...........eee....eeeeee......eeehhhhhhhhh..hhhh.eeeeeee....eeeee..eeeee....eeee......eeeee........eeeeeee.......eee.......eee........eeeeeee..........eeeeeee........--------.eeeeeee.......eeeee......eeeee...eeeee.......eee....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1x8m F 6002 SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNT--------RMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVF 6268
                                  6011      6021      6031      6041      6051      6061      6071      6081      6091      6101      6111      6121      6131      6141      6151      6161      6171      6181      6191  |      - |    6211      6221      6231      6241      6251      6261       
                                                                                                                                                                                                                         6194     6203
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 12)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
(-)
Architecture: Sandwich (5577)
(-)
Topology: Jelly Rolls (1293)
(-)
Homologous Superfamily: 4-deoxy-l-threo-5-hexosulose-uronate ketol- isomerase; domain 2 (2)
(-)
Escherichia coli. Organism_taxid: 562. (2)
1a1x8mA02A:1010-1031,A:1146-1268
1b1x8mB02B:2010-2031,B:2146-2268
1c1x8mC02C:3010-3031,C:3146-3268
1d1x8mD02D:4010-4031,D:4146-4268
1e1x8mE02E:5010-5031,E:5146-5268
1f1x8mF02F:6010-6031,F:6146-6268
(-)
Homologous Superfamily: pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1 (2)
(-)
Escherichia coli. Organism_taxid: 562. (2)
2a1x8mA01A:1002-1009,A:1032-1145
2b1x8mB01B:2002-2009,B:2032-2145
2c1x8mC01C:3002-3009,C:3032-3145
2d1x8mD01D:4002-4009,D:4032-4145
2e1x8mE01E:5002-5009,E:5032-5145
2f1x8mF01F:6002-6009,F:6032-6145

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1X8M)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (KDUI_ECOLI | Q46938)
molecular function
    GO:0008697    4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase activity    Catalysis of the reaction: 5-dehydro-4-deoxy-D-glucuronate = 3-deoxy-D-glycero-2,5-hexodiulosonate.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016861    intramolecular oxidoreductase activity, interconverting aldoses and ketoses    Catalysis of an oxidation-reduction (redox) reaction in which the hydrogen donor and acceptor, which is an aldose or a ketose, are the same molecule, and no oxidized product appears.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0019698    D-galacturonate catabolic process    The chemical reactions and pathways resulting in the breakdown of D-galacturonate, the D-enantiomer of galacturonate, the anion of galacturonic acid.
    GO:0042840    D-glucuronate catabolic process    The chemical reactions and pathways resulting in the breakdown of D-glucuronate, the D-enantiomer of glucuronate.
    GO:0045490    pectin catabolic process    The chemical reactions and pathways resulting in the breakdown of pectin, a polymer containing a backbone of alpha-1,4-linked D-galacturonic acid residues.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x8m)
 
  Sites
(no "Sites" information available for 1x8m)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x8m)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1x8m
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KDUI_ECOLI | Q46938
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.1.17
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KDUI_ECOLI | Q46938
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KDUI_ECOLI | Q46938: 1xru

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1X8M)