|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1X25) |
Sites (0, 0)| (no "Site" information available for 1X25) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1X25) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1X25) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1X25) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1X25) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:126 aligned with Y811_SULTO | Q973T6 from UniProtKB/Swiss-Prot Length:125 Alignment length:126 1 | 8 18 28 38 48 58 68 78 88 98 108 118 Y811_SULTO - --METVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK 124 SCOP domains --d1x25a1 A:1-124 Hypothetical protein ST0811 SCOP domains CATH domains 1x25A00 A:-1-124 [code=3.30.1330.40, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -----------------------------------------------------------------------------------------------------UPF0076 ------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 1x25 A -1 SHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK 124 8 18 28 38 48 58 68 78 88 98 108 118 Chain B from PDB Type:PROTEIN Length:128 aligned with Y811_SULTO | Q973T6 from UniProtKB/Swiss-Prot Length:125 Alignment length:128 1 | 7 17 27 37 47 57 67 77 87 97 107 117 Y811_SULTO - ---METVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSKG 125 SCOP domains d1x25b_ B: Hypothetical protein ST0811 SCOP domains CATH domains 1x25B00 B:-2-125 [code=3.30.1330.40, no name defined] CATH domains Pfam domains (1) --------Ribonuc_L-PSP-1x25B01 B:6-124 - Pfam domains (1) Pfam domains (2) --------Ribonuc_L-PSP-1x25B02 B:6-124 - Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------UPF0076 ------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 1x25 B -2 GSHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSKG 125 7 17 27 37 47 57 67 77 87 97 107 117
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1X25)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|