1X1G - JenaLib

Title :   SOLUTION STRUCTURE OF THE C-TERMINAL PH DOMAIN OF HUMAN PLECKSTRIN 2

Authors :   H. Li, T. Tomizawa, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   04 Apr 05 (Deposition) - 04 Oct 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Pleckstrin 2, Ph Domain, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Nppsfa, National Project On Protein Structural And Functional Analyses, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Li, T. Tomizawa, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structure Of The C-Terminal Ph Domain Of Human Pleckstrin 2
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 20)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (6, 6)

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000216446	1	ENSE00001140438	chr14:67878828-67878735	94	PLEK2_HUMAN	1-14	14	0	-	-
1.2	ENST00000216446	2	ENSE00000807769	chr14:67864543-67864379	165	PLEK2_HUMAN	15-69	55	0	-	-
1.3	ENST00000216446	3	ENSE00000658607	chr14:67862300-67862119	182	PLEK2_HUMAN	70-130	61	0	-	-
1.4	ENST00000216446	4	ENSE00000658606	chr14:67859958-67859867	92	PLEK2_HUMAN	130-161	32	1	A:1-4 (gaps)	10
1.5	ENST00000216446	5	ENSE00000658605	chr14:67859566-67859379	188	PLEK2_HUMAN	161-223	63	1	A:4-7 (gaps)	47
1.6	ENST00000216446	6	ENSE00000658604	chr14:67859144-67859043	102	PLEK2_HUMAN	224-257	34	1	A:8-27	20
1.7	ENST00000216446	7	ENSE00000658602	chr14:67857463-67857380	84	PLEK2_HUMAN	258-285	28	1	A:28-55	28
1.8	ENST00000216446	8	ENSE00000658600	chr14:67855019-67854941	79	PLEK2_HUMAN	286-312	27	1	A:56-82	27
1.9	ENST00000216446	9	ENSE00001168415	chr14:67854173-67853702	472	PLEK2_HUMAN	312-353	42	1	A:82-123	42

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:129
 aligned with PLEK2_HUMAN | Q9NYT0 from UniProtKB/Swiss-Prot  Length:353

    Alignment length:208
                                                                                                                                                                                                                                   353      
                                   161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351 |      
          PLEK2_HUMAN   152 GSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT------   -
               SCOP domains --------------------------------------------------------------------------------------d1x1ga1 A:8-123 Pleckstrin-2                                                                                        ------ SCOP domains
               CATH domains 1x1      gA                                           00                               A:1-129 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------PH-1x1gA01 A:18-123                                                                                       ------ Pfam domains
         Sec.struct. author ...------..-------------------------------------------..------------------------------.........eeeeeeeeeee......eeeeeeeeee...eeeee............ee....eeee..................eeee......eeee...hhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------PH_DOMAIN  PDB: A:17-123 UniProt: 247-353                                                                  ------ PROSITE
           Transcript 1 (1) Exon 1.4  --------------------------------------------------------------Exon 1.6  PDB: A:8-27 [INCOMPLETE]Exon 1.7  PDB: A:28-55      Exon 1.8  PDB: A:56-82     ----------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------Exon 1.5  PDB: A:4-7 (gaps) UniProt: 161-223 [INCOMPLETE]      ----------------------------------------------------------------------------------------Exon 1.9  PDB: A:82-123 UniProt: 312-353  ------ Transcript 1 (2)
                 1x1g A   1 GSS------GS-------------------------------------------SG------------------------------SLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLTSGPSSG 129
                              |      4|        -         -         -         -    ||   -         -         -      | 11        21        31        41        51        61        71        81        91       101       111       121        
                              3      4|                                           6|                              8                                                                                                                         
                                      5                                            7

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

NMR Structure(hide GO term definitions)

Chain A (PLEK2_HUMAN | Q9NYT0)

biological process
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0031258	lamellipodium membrane	The portion of the plasma membrane surrounding a lamellipodium.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x1g)

	Sites
(no "Sites" information available for 1x1g)

	Cis Peptide Bonds
		Asp A:44 - Pro A:45	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1x1g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PLEK2_HUMAN \| Q9NYT0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description