1X0H - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE CARBOXYL-TERMINAL RGC DOMAIN IN HUMAN IQGAP1

Authors :   K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   23 Mar 05 (Deposition) - 23 Sep 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Cell Adhesion, Beta-Sandwich, Protein-Protein Interaction, Structural Genomics, Nppsfa, Riken Structural Genomics/Proteomics Initiative, Rsgi, National Project On Protein Structural And Functional Analyses, Signaling Protein, Nppsfa, National Project On Protein Structural And Functional Analyses (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structure Of The Carboxyl-Terminal Rgc Domain In Human Iqgap1
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - RAS GTPASE-ACTIVATING-LIKE PROTEIN IQGAP1
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040816-19
	Expression System Vector Type	:	PLASMID
	Fragment	:	RGC DOMAIN
	Gene	:	KAZUSA CDNA HA00940
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	P195


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1X0H)

(no "Site" information available for 1X0H)

(no "SS Bond" information available for 1X0H)

(no "Cis Peptide Bond" information available for 1X0H)

(no "SAP(SNP)/Variant" information available for 1X0H)

(no "PROSITE Motif" information available for 1X0H)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000268182	1	ENSE00001304261	chr15:90931450-90931628	179	IQGA1_HUMAN	1-19	19	0	-	-
1.2	ENST00000268182	2	ENSE00001637194	chr15:90934006-90934105	100	IQGA1_HUMAN	19-52	34	0	-	-
1.3	ENST00000268182	3	ENSE00000943994	chr15:90969342-90969498	157	IQGA1_HUMAN	52-104	53	0	-	-
1.4	ENST00000268182	4	ENSE00000943995	chr15:90972821-90972898	78	IQGA1_HUMAN	105-130	26	0	-	-
1.5	ENST00000268182	5	ENSE00000943996	chr15:90976951-90977027	77	IQGA1_HUMAN	131-156	26	0	-	-
1.6	ENST00000268182	6	ENSE00001799868	chr15:90982564-90982631	68	IQGA1_HUMAN	156-179	24	0	-	-
1.7	ENST00000268182	7	ENSE00000943998	chr15:90983734-90983847	114	IQGA1_HUMAN	179-217	39	0	-	-
1.8	ENST00000268182	8	ENSE00000943999	chr15:90984738-90984916	179	IQGA1_HUMAN	217-276	60	0	-	-
1.9	ENST00000268182	9	ENSE00000944000	chr15:90986626-90986710	85	IQGA1_HUMAN	277-305	29	0	-	-
1.10	ENST00000268182	10	ENSE00000944001	chr15:90991805-90991968	164	IQGA1_HUMAN	305-359	55	0	-	-
1.11	ENST00000268182	11	ENSE00000944002	chr15:90992791-90992875	85	IQGA1_HUMAN	360-388	29	0	-	-
1.12	ENST00000268182	12	ENSE00000944003	chr15:90996007-90996170	164	IQGA1_HUMAN	388-442	55	0	-	-
1.13	ENST00000268182	13	ENSE00000944004	chr15:90996364-90996524	161	IQGA1_HUMAN	443-496	54	0	-	-
1.14	ENST00000268182	14	ENSE00000944005	chr15:90997660-90997784	125	IQGA1_HUMAN	496-538	43	0	-	-
1.15	ENST00000268182	15	ENSE00000944006	chr15:90999384-90999547	164	IQGA1_HUMAN	538-592	55	0	-	-
1.16	ENST00000268182	16	ENSE00000944007	chr15:91009233-91009323	91	IQGA1_HUMAN	593-623	31	0	-	-
1.17	ENST00000268182	17	ENSE00000944008	chr15:91009501-91009668	168	IQGA1_HUMAN	623-679	57	0	-	-
1.18	ENST00000268182	18	ENSE00000944009	chr15:91010682-91010824	143	IQGA1_HUMAN	679-726	48	0	-	-
1.19	ENST00000268182	19	ENSE00000944010	chr15:91016072-91016242	171	IQGA1_HUMAN	727-783	57	0	-	-
1.20	ENST00000268182	20	ENSE00000944011	chr15:91016947-91017030	84	IQGA1_HUMAN	784-811	28	0	-	-
1.21	ENST00000268182	21	ENSE00000944012	chr15:91017128-91017199	72	IQGA1_HUMAN	812-835	24	0	-	-
1.22	ENST00000268182	22	ENSE00000944013	chr15:91017296-91017365	70	IQGA1_HUMAN	836-859	24	0	-	-
1.23	ENST00000268182	23	ENSE00000944014	chr15:91017717-91017925	209	IQGA1_HUMAN	859-928	70	0	-	-
1.24	ENST00000268182	24	ENSE00000944015	chr15:91019895-91020050	156	IQGA1_HUMAN	929-980	52	0	-	-
1.25	ENST00000268182	25	ENSE00001705272	chr15:91020299-91020462	164	IQGA1_HUMAN	981-1035	55	0	-	-
1.26	ENST00000268182	26	ENSE00000944017	chr15:91020897-91021121	225	IQGA1_HUMAN	1035-1110	76	0	-	-
1.27	ENST00000268182	27	ENSE00000944018	chr15:91025192-91025332	141	IQGA1_HUMAN	1110-1157	48	0	-	-
1.28	ENST00000268182	28	ENSE00000944019	chr15:91025429-91025513	85	IQGA1_HUMAN	1157-1185	29	0	-	-
1.29	ENST00000268182	29	ENSE00000944020	chr15:91026593-91026825	233	IQGA1_HUMAN	1186-1263	78	0	-	-
1.30	ENST00000268182	30	ENSE00000944021	chr15:91027452-91027584	133	IQGA1_HUMAN	1263-1307	45	0	-	-
1.31	ENST00000268182	31	ENSE00000944022	chr15:91029262-91029364	103	IQGA1_HUMAN	1308-1342	35	0	-	-
1.32	ENST00000268182	32	ENSE00000944023	chr15:91030186-91030321	136	IQGA1_HUMAN	1342-1387	46	0	-	-
1.33	ENST00000268182	33	ENSE00000944024	chr15:91030727-91030814	88	IQGA1_HUMAN	1387-1416	30	0	-	-
1.34	ENST00000268182	34	ENSE00000944025	chr15:91034565-91034777	213	IQGA1_HUMAN	1417-1487	71	0	-	-
1.35	ENST00000268182	35	ENSE00000944026	chr15:91035777-91035943	167	IQGA1_HUMAN	1488-1543	56	1	A:1-4	4
1.36	ENST00000268182	36	ENSE00000944027	chr15:91037945-91038067	123	IQGA1_HUMAN	1543-1584	42	1	A:5-33	29
1.37	ENST00000268182	37	ENSE00001292387	chr15:91040464-91040572	109	IQGA1_HUMAN	1584-1620	37	1	A:33-69	37
1.38	ENST00000268182	38	ENSE00001317184	chr15:91043227-91045475	2249	IQGA1_HUMAN	1621-1657	37	1	A:70-106	37

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:112
 aligned with IQGA1_HUMAN | P46940 from UniProtKB/Swiss-Prot  Length:1657

    Alignment length:125
                                                                                                                                               1657      
                                  1548      1558      1568      1578      1588      1598      1608      1618      1628      1638      1648        |-     
         IQGA1_HUMAN   1539 ASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK------    -
               SCOP domains --------------------d1x0ha1 A:8-107 Ras GTPase-activating-like protein IQGAP1                                           ----- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------RasGAP_C-1x0hA01 A:8-32  -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-------------.....eeeehhhhhhhh.eeee....hhhhhh.eeeee.......eeeeee........eeehhhhhhhhhhhh..eeee...eeeehhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.35 ----------------------------------------Exon 1.37  PDB: A:33-69              Exon 1.38  PDB: A:70-106             ------ Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.36  PDB: A:5-33 UniProt: 1543-1584 ------------------------------------------------------------------------------- Transcript 1 (2)
                1x0h A    1 GSSG-------------SSGISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGKSGPSSG  112
                               |     -       | 7        17        27        37        47        57        67        77        87        97       107     
                               4             5

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: RGC domain-like (3)

Superfamily: RGC domain-like (3)

Family: RGC domain (3)

Protein domain: Ras GTPase-activating-like protein IQGAP1 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d1x0ha1

A:8-107

(no "CATH Domain" information available for 1X0H)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: RasGAP_C] (1)

Family: RasGAP_C (1)

Homo sapiens (Human) (1)

RasGAP_C-1x0hA01

A:8-32

NMR Structure(hide GO term definitions)

Chain A (IQGA1_HUMAN | P46940)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005095	GTPase inhibitor activity	Stops, prevents or reduces the activity of any enzyme that catalyzes the hydrolysis of GTP to GDP and orthophosphate.
	GO:0048365	Rac GTPase binding	Interacting selectively and non-covalently with Rac protein, any member of the Rac subfamily of the Ras superfamily of monomeric GTPases.
	GO:0017048	Rho GTPase binding	Interacting selectively and non-covalently with Rho protein, any member of the Rho subfamily of the Ras superfamily of monomeric GTPases. Proteins in the Rho subfamily are involved in relaying signals from cell-surface receptors to the actin cytoskeleton.
	GO:0044548	S100 protein binding	Interacting selectively and non-covalently with a S100 protein. S100 is a small calcium and zinc binding protein produced in astrocytes that is implicated in Alzheimer's disease, Down Syndrome and ALS.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-3,4,5-trisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3', 4' and 5' positions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0019903	protein phosphatase binding	Interacting selectively and non-covalently with any protein phosphatase.
	GO:0043539	protein serine/threonine kinase activator activity	Binds to and increases the activity of a protein serine/threonine kinase.
biological process
	GO:0071277	cellular response to calcium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0071364	cellular response to epidermal growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epidermal growth factor stimulus.
	GO:0044344	cellular response to fibroblast growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an fibroblast growth factor stimulus.
	GO:0036120	cellular response to platelet-derived growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platelet-derived growth factor stimulus.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0072015	glomerular visceral epithelial cell development	The process whose specific outcome is the progression of a glomerular visceral epithelial cell over time, from its formation to the mature structure. A glomerular visceral epithelial cell is a specialized epithelial cell that contains "feet" that interdigitate with the "feet" of other glomerular epithelial cells.
	GO:0034260	negative regulation of GTPase activity	Any process that stops or reduces the rate of GTP hydrolysis by a GTPase.
	GO:0035305	negative regulation of dephosphorylation	Any process the stops, prevents, or reduces the frequency, rate or extent of removal of phosphate groups from a molecule.
	GO:1990138	neuron projection extension	Long distance growth of a single neuron projection involved in cellular development. A neuron projection is a prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0048008	platelet-derived growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0045860	positive regulation of protein kinase activity	Any process that activates or increases the frequency, rate or extent of protein kinase activity.
	GO:0071902	positive regulation of protein serine/threonine kinase activity	Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
	GO:0043087	regulation of GTPase activity	Any process that modulates the rate of GTP hydrolysis by a GTPase.
	GO:0001817	regulation of cytokine production	Any process that modulates the frequency, rate, or extent of production of a cytokine.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0031252	cell leading edge	The area of a motile cell closest to the direction of movement.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0036464	cytoplasmic ribonucleoprotein granule	A ribonucleoprotein granule located in the cytoplasm.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0030426	growth cone	The migrating motile tip of a growing nerve cell axon or dendrite.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0016328	lateral plasma membrane	The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005874	microtubule	Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
	GO:0015630	microtubule cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
	GO:0030496	midbody	A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
	GO:0036057	slit diaphragm	A specialized cell-cell junction found between the interdigitating foot processes of the glomerular epithelium (the podocytes) in the vertebrate kidney, which is adapted for facilitating glomerular filtration.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x0h)

	Sites
(no "Sites" information available for 1x0h)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x0h)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1x0h
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IQGA1_HUMAN \| P46940
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IQGA1_HUMAN \| P46940
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IQGA1_HUMAN \| P46940	:	2rr8 3fay 3i6x 5l0o

(no "Related Entries Specified in the PDB File" available for 1X0H)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (55, 55)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File