Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE CARBOXYL-TERMINAL RGC DOMAIN IN HUMAN IQGAP1
 
Authors :  K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  23 Mar 05  (Deposition) - 23 Sep 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Cell Adhesion, Beta-Sandwich, Protein-Protein Interaction, Structural Genomics, Nppsfa, Riken Structural Genomics/Proteomics Initiative, Rsgi, National Project On Protein Structural And Functional Analyses, Signaling Protein, Nppsfa, National Project On Protein Structural And Functional Analyses (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structure Of The Carboxyl-Terminal Rgc Domain In Human Iqgap1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RAS GTPASE-ACTIVATING-LIKE PROTEIN IQGAP1
    ChainsA
    EngineeredYES
    Expression System PlasmidP040816-19
    Expression System Vector TypePLASMID
    FragmentRGC DOMAIN
    GeneKAZUSA CDNA HA00940
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymP195

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1X0H)

(-) Sites  (0, 0)

(no "Site" information available for 1X0H)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1X0H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1X0H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1X0H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1X0H)

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002681821ENSE00001304261chr15:90931450-90931628179IQGA1_HUMAN1-19190--
1.2ENST000002681822ENSE00001637194chr15:90934006-90934105100IQGA1_HUMAN19-52340--
1.3ENST000002681823ENSE00000943994chr15:90969342-90969498157IQGA1_HUMAN52-104530--
1.4ENST000002681824ENSE00000943995chr15:90972821-9097289878IQGA1_HUMAN105-130260--
1.5ENST000002681825ENSE00000943996chr15:90976951-9097702777IQGA1_HUMAN131-156260--
1.6ENST000002681826ENSE00001799868chr15:90982564-9098263168IQGA1_HUMAN156-179240--
1.7ENST000002681827ENSE00000943998chr15:90983734-90983847114IQGA1_HUMAN179-217390--
1.8ENST000002681828ENSE00000943999chr15:90984738-90984916179IQGA1_HUMAN217-276600--
1.9ENST000002681829ENSE00000944000chr15:90986626-9098671085IQGA1_HUMAN277-305290--
1.10ENST0000026818210ENSE00000944001chr15:90991805-90991968164IQGA1_HUMAN305-359550--
1.11ENST0000026818211ENSE00000944002chr15:90992791-9099287585IQGA1_HUMAN360-388290--
1.12ENST0000026818212ENSE00000944003chr15:90996007-90996170164IQGA1_HUMAN388-442550--
1.13ENST0000026818213ENSE00000944004chr15:90996364-90996524161IQGA1_HUMAN443-496540--
1.14ENST0000026818214ENSE00000944005chr15:90997660-90997784125IQGA1_HUMAN496-538430--
1.15ENST0000026818215ENSE00000944006chr15:90999384-90999547164IQGA1_HUMAN538-592550--
1.16ENST0000026818216ENSE00000944007chr15:91009233-9100932391IQGA1_HUMAN593-623310--
1.17ENST0000026818217ENSE00000944008chr15:91009501-91009668168IQGA1_HUMAN623-679570--
1.18ENST0000026818218ENSE00000944009chr15:91010682-91010824143IQGA1_HUMAN679-726480--
1.19ENST0000026818219ENSE00000944010chr15:91016072-91016242171IQGA1_HUMAN727-783570--
1.20ENST0000026818220ENSE00000944011chr15:91016947-9101703084IQGA1_HUMAN784-811280--
1.21ENST0000026818221ENSE00000944012chr15:91017128-9101719972IQGA1_HUMAN812-835240--
1.22ENST0000026818222ENSE00000944013chr15:91017296-9101736570IQGA1_HUMAN836-859240--
1.23ENST0000026818223ENSE00000944014chr15:91017717-91017925209IQGA1_HUMAN859-928700--
1.24ENST0000026818224ENSE00000944015chr15:91019895-91020050156IQGA1_HUMAN929-980520--
1.25ENST0000026818225ENSE00001705272chr15:91020299-91020462164IQGA1_HUMAN981-1035550--
1.26ENST0000026818226ENSE00000944017chr15:91020897-91021121225IQGA1_HUMAN1035-1110760--
1.27ENST0000026818227ENSE00000944018chr15:91025192-91025332141IQGA1_HUMAN1110-1157480--
1.28ENST0000026818228ENSE00000944019chr15:91025429-9102551385IQGA1_HUMAN1157-1185290--
1.29ENST0000026818229ENSE00000944020chr15:91026593-91026825233IQGA1_HUMAN1186-1263780--
1.30ENST0000026818230ENSE00000944021chr15:91027452-91027584133IQGA1_HUMAN1263-1307450--
1.31ENST0000026818231ENSE00000944022chr15:91029262-91029364103IQGA1_HUMAN1308-1342350--
1.32ENST0000026818232ENSE00000944023chr15:91030186-91030321136IQGA1_HUMAN1342-1387460--
1.33ENST0000026818233ENSE00000944024chr15:91030727-9103081488IQGA1_HUMAN1387-1416300--
1.34ENST0000026818234ENSE00000944025chr15:91034565-91034777213IQGA1_HUMAN1417-1487710--
1.35ENST0000026818235ENSE00000944026chr15:91035777-91035943167IQGA1_HUMAN1488-1543561A:1-44
1.36ENST0000026818236ENSE00000944027chr15:91037945-91038067123IQGA1_HUMAN1543-1584421A:5-3329
1.37ENST0000026818237ENSE00001292387chr15:91040464-91040572109IQGA1_HUMAN1584-1620371A:33-6937
1.38ENST0000026818238ENSE00001317184chr15:91043227-910454752249IQGA1_HUMAN1621-1657371A:70-10637

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:112
 aligned with IQGA1_HUMAN | P46940 from UniProtKB/Swiss-Prot  Length:1657

    Alignment length:125
                                                                                                                                               1657      
                                  1548      1558      1568      1578      1588      1598      1608      1618      1628      1638      1648        |-     
         IQGA1_HUMAN   1539 ASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK------    -
               SCOP domains --------------------d1x0ha1 A:8-107 Ras GTPase-activating-like protein IQGAP1                                           ----- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------RasGAP_C-1x0hA01 A:8-32  -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-------------.....eeeehhhhhhhh.eeee....hhhhhh.eeeee.......eeeeee........eeehhhhhhhhhhhh..eeee...eeeehhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.35 ----------------------------------------Exon 1.37  PDB: A:33-69              Exon 1.38  PDB: A:70-106             ------ Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.36  PDB: A:5-33 UniProt: 1543-1584 ------------------------------------------------------------------------------- Transcript 1 (2)
                1x0h A    1 GSSG-------------SSGISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGKSGPSSG  112
                               |     -       | 7        17        27        37        47        57        67        77        87        97       107     
                               4             5                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1X0H)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (55, 55)

NMR Structure(hide GO term definitions)
Chain A   (IQGA1_HUMAN | P46940)
molecular function
    GO:0005096    GTPase activator activity    Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
    GO:0005095    GTPase inhibitor activity    Stops, prevents or reduces the activity of any enzyme that catalyzes the hydrolysis of GTP to GDP and orthophosphate.
    GO:0048365    Rac GTPase binding    Interacting selectively and non-covalently with Rac protein, any member of the Rac subfamily of the Ras superfamily of monomeric GTPases.
    GO:0017048    Rho GTPase binding    Interacting selectively and non-covalently with Rho protein, any member of the Rho subfamily of the Ras superfamily of monomeric GTPases. Proteins in the Rho subfamily are involved in relaying signals from cell-surface receptors to the actin cytoskeleton.
    GO:0044548    S100 protein binding    Interacting selectively and non-covalently with a S100 protein. S100 is a small calcium and zinc binding protein produced in astrocytes that is implicated in Alzheimer's disease, Down Syndrome and ALS.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005516    calmodulin binding    Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
    GO:0005547    phosphatidylinositol-3,4,5-trisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-3,4,5-trisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3', 4' and 5' positions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0019903    protein phosphatase binding    Interacting selectively and non-covalently with any protein phosphatase.
    GO:0043539    protein serine/threonine kinase activator activity    Binds to and increases the activity of a protein serine/threonine kinase.
biological process
    GO:0071277    cellular response to calcium ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0071364    cellular response to epidermal growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epidermal growth factor stimulus.
    GO:0044344    cellular response to fibroblast growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an fibroblast growth factor stimulus.
    GO:0036120    cellular response to platelet-derived growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platelet-derived growth factor stimulus.
    GO:0007173    epidermal growth factor receptor signaling pathway    A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0072015    glomerular visceral epithelial cell development    The process whose specific outcome is the progression of a glomerular visceral epithelial cell over time, from its formation to the mature structure. A glomerular visceral epithelial cell is a specialized epithelial cell that contains "feet" that interdigitate with the "feet" of other glomerular epithelial cells.
    GO:0034260    negative regulation of GTPase activity    Any process that stops or reduces the rate of GTP hydrolysis by a GTPase.
    GO:0035305    negative regulation of dephosphorylation    Any process the stops, prevents, or reduces the frequency, rate or extent of removal of phosphate groups from a molecule.
    GO:1990138    neuron projection extension    Long distance growth of a single neuron projection involved in cellular development. A neuron projection is a prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0048008    platelet-derived growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0045860    positive regulation of protein kinase activity    Any process that activates or increases the frequency, rate or extent of protein kinase activity.
    GO:0071902    positive regulation of protein serine/threonine kinase activity    Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0043087    regulation of GTPase activity    Any process that modulates the rate of GTP hydrolysis by a GTPase.
    GO:0001817    regulation of cytokine production    Any process that modulates the frequency, rate, or extent of production of a cytokine.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007264    small GTPase mediated signal transduction    Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0005884    actin filament    A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0031252    cell leading edge    The area of a motile cell closest to the direction of movement.
    GO:0005911    cell-cell junction    A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0036464    cytoplasmic ribonucleoprotein granule    A ribonucleoprotein granule located in the cytoplasm.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031234    extrinsic component of cytoplasmic side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0030426    growth cone    The migrating motile tip of a growing nerve cell axon or dendrite.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0016328    lateral plasma membrane    The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0015630    microtubule cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
    GO:0030496    midbody    A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0001726    ruffle    Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
    GO:0036057    slit diaphragm    A specialized cell-cell junction found between the interdigitating foot processes of the glomerular epithelium (the podocytes) in the vertebrate kidney, which is adapted for facilitating glomerular filtration.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x0h)
 
  Sites
(no "Sites" information available for 1x0h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x0h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1x0h
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IQGA1_HUMAN | P46940
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IQGA1_HUMAN | P46940
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IQGA1_HUMAN | P469402rr8 3fay 3i6x 5l0o

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1X0H)