1WYN - JenaLib

Title :   SOLUTION STRUCTURE OF THE CH DOMAIN OF HUMAN CALPONIN-2

Authors :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   15 Feb 05 (Deposition) - 15 Aug 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Ch Domain, F-Actin Binding, All Alpha Helix, Structural Genomics, Nppsfa, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Ch Domain Of Human Calponin-2
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 2)

Exons (6, 6)

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000263097	1a	ENSE00001374934	chr19:1026298-1026723	426	CNN2_HUMAN	1-21	21	1	A:1-9	9
1.2b	ENST00000263097	2b	ENSE00000951213	chr19:1031070-1031191	122	CNN2_HUMAN	22-62	41	1	A:10-50	41
1.3	ENST00000263097	3	ENSE00000728651	chr19:1032391-1032457	67	CNN2_HUMAN	62-84	23	1	A:50-72	23
1.4	ENST00000263097	4	ENSE00000728647	chr19:1032558-1032695	138	CNN2_HUMAN	85-130	46	1	A:73-118	46
1.5	ENST00000263097	5	ENSE00000728644	chr19:1036129-1036245	117	CNN2_HUMAN	131-169	39	1	A:119-140	22
1.6	ENST00000263097	6	ENSE00000518471	chr19:1036415-1036561	147	CNN2_HUMAN	170-218	49	1	A:141-146	6
1.7	ENST00000263097	7	ENSE00001279469	chr19:1037624-1039060	1437	CNN2_HUMAN	219-309	91	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:146
 aligned with CNN2_HUMAN | Q99439 from UniProtKB/Swiss-Prot  Length:309

    Alignment length:168
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        
           CNN2_HUMAN    13 GLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG 180
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ----------------1wynA01 A:17-124 Actin-binding Protein, T-fimbrin; domain 1                                                 -------------------------------------------- CATH domains
               Pfam domains ------------------CH-1wynA01 A:19-120                                                                                   ------------------------------------------------ Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhh.....hhhhhhhh.hhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhh.......hhhhhhh...hhhhhhhhhhhhhhhh....................----------------------...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------CH  PDB: A:16-119 UniProt: 28-131                                                                       ----------------------------------CALPONIN_1      PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------CALPONIN_2      PROSITE (2)
           Transcript 1 (1) Exon 1.1aExon 1.2b  PDB: A:10-50 UniProt: 22-62   ----------------------Exon 1.4  PDB: A:73-118 UniProt: 85-130       Exon 1.5  PDB: A:119-140 [INCOMPLETE]  Exon 1.6    Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.3  PDB: A:50-72 ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1wyn A   1 GSSGSSGNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQER----------------------SGPSSG 146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         -         -  |     
                                                                                                                                                                     140                    141

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (12, 12)

NMR Structure(hide GO term definitions)

Chain A (CNN2_HUMAN | Q99439)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
biological process
	GO:0031032	actomyosin structure organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures containing both actin and myosin or paramyosin. The myosin may be organized into filaments.
	GO:0071260	cellular response to mechanical stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0007010	cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
	GO:0032970	regulation of actin filament-based process	Any process that modulates the frequency, rate or extent of any cellular process that depends upon or alters the actin cytoskeleton.
cellular component
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0001725	stress fiber	A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wyn)

	Sites
(no "Sites" information available for 1wyn)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wyn)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1wyn
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CNN2_HUMAN \| Q99439
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description