1WXB - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE SH3 DOMAIN FROM HUMAN EPIDERMAL GROWTH FACTOR RECEPTOR PATHWAY SUBSTRATE 8-LIKE PROTEIN

Authors :   E. Chikayama, T. Kigawa, Y. Muto, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   20 Jan 05 (Deposition) - 20 Jul 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Sh3, Eps8, Eps8L2, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Chikayama, T. Kigawa, Y. Muto, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Sh3 Domain From Human Epidermal Growth Factor Receptor Pathway Substrate 8-Like Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - EPIDERMAL GROWTH FACTOR RECEPTOR PATHWAY SUBSTRATE 8-LIKE PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040329-30
	Expression System Vector Type	:	PLASMID
	Fragment	:	SH3
	Gene	:	EPS8L2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WXB)

Sites (0, 0)

(no "Site" information available for 1WXB)

SS Bonds (0, 0)

(no "SS Bond" information available for 1WXB)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1WXB)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 1WXB)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH3	PS50002	Src homology 3 (SH3) domain profile.	ES8L2_HUMAN	492-551	1	A:8-62

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000318562	3a	ENSE00002157327	chr11:706113-706288	176	ES8L2_HUMAN	-	0	0	-	-
1.6a	ENST00000318562	6a	ENSE00002163347	chr11:709330-709451	122	ES8L2_HUMAN	1-15	15	0	-	-
1.7b	ENST00000318562	7b	ENSE00001411042	chr11:709553-709608	56	ES8L2_HUMAN	15-34	20	0	-	-
1.7j	ENST00000318562	7j	ENSE00001422334	chr11:710422-710486	65	ES8L2_HUMAN	34-55	22	0	-	-
1.8f	ENST00000318562	8f	ENSE00001418698	chr11:720062-720223	162	ES8L2_HUMAN	56-109	54	0	-	-
1.9b	ENST00000318562	9b	ENSE00001430201	chr11:720597-720746	150	ES8L2_HUMAN	110-159	50	0	-	-
1.10b	ENST00000318562	10b	ENSE00001425961	chr11:720830-720909	80	ES8L2_HUMAN	160-186	27	0	-	-
1.11c	ENST00000318562	11c	ENSE00001415198	chr11:721064-721206	143	ES8L2_HUMAN	186-234	49	0	-	-
1.11i	ENST00000318562	11i	ENSE00001410051	chr11:721285-721352	68	ES8L2_HUMAN	234-256	23	0	-	-
1.12b	ENST00000318562	12b	ENSE00001421399	chr11:721565-721691	127	ES8L2_HUMAN	257-299	43	0	-	-
1.12g	ENST00000318562	12g	ENSE00001419127	chr11:721903-721991	89	ES8L2_HUMAN	299-328	30	0	-	-
1.12i	ENST00000318562	12i	ENSE00001429313	chr11:722091-722165	75	ES8L2_HUMAN	329-353	25	0	-	-
1.12l	ENST00000318562	12l	ENSE00001405108	chr11:722401-722549	149	ES8L2_HUMAN	354-403	50	0	-	-
1.13a	ENST00000318562	13a	ENSE00001258551	chr11:722673-722805	133	ES8L2_HUMAN	403-447	45	0	-	-
1.14a	ENST00000318562	14a	ENSE00001258544	chr11:723241-723353	113	ES8L2_HUMAN	448-485	38	1	A:1-3 (gaps)	9
1.15b	ENST00000318562	15b	ENSE00001258537	chr11:724724-724829	106	ES8L2_HUMAN	485-520	36	1	A:4-33 (gaps)	35
1.16	ENST00000318562	16	ENSE00001258529	chr11:725728-725847	120	ES8L2_HUMAN	521-560	40	1	A:34-63	30
1.17b	ENST00000318562	17b	ENSE00001258518	chr11:726098-726170	73	ES8L2_HUMAN	561-585	25	1	A:64-68 (gaps)	15
1.17c	ENST00000318562	17c	ENSE00001410509	chr11:726304-726484	181	ES8L2_HUMAN	585-645	61	0	-	-
1.18c	ENST00000318562	18c	ENSE00001408404	chr11:726619-726751	133	ES8L2_HUMAN	645-689	45	0	-	-
1.19h	ENST00000318562	19h	ENSE00002163664	chr11:726901-727727	827	ES8L2_HUMAN	690-715	26	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:68
 aligned with ES8L2_HUMAN | Q9H6S3 from UniProtKB/Swiss-Prot  Length:715

    Alignment length:110
                                   481       491       501       511       521       531       541       551       561       571       581
          ES8L2_HUMAN   472 GDALPPVSSPHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGYVPCNILGEARPEDAGAPFEQAGQKYWGPASPTHKLPPSFPG 581
               SCOP domains d      1w     x     ba_ A: automated matches                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------SH3_1-1wxbA01 A:11-56                         -------------------------------------- Pfam domains
         Sec.struct. author .------..-----.-----.....ee...................eeeeee....eeeee.....eeeee........----------------....----------. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------SH3  PDB: A:8-62 UniProt: 492-551                           ------------------------------ PROSITE
           Transcript 1 (1) Exon 1.14a    -----------------------------------Exon 1.16  PDB: A:34-63 UniProt: 521-560Exon 1.17b            Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.15b  PDB: A:4-33 (gaps)      ------------------------------------------------------------- Transcript 1 (2)
                 1wxb A   1 G------SS-----G-----SSGKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGYVPCNILGEAS----------------GPSS----------G  68
                            |      ||-    |    -|       14        24        34        44        54        |-         -     |  |-        68
                            |      2|     4     5                                                        63               64 67         68
                            1       3

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: SH3-domain (369)

Family: automated matches (114)

Protein domain: automated matches (114)

Human (Homo sapiens) [TaxId: 9606] (74)

d1wxba_

CATH Domains (0, 0)

(no "CATH Domain" information available for 1WXB)

Pfam Domains (1, 1)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: SH3 (175)

Family: SH3_1 (141)

Homo sapiens (Human) (69)

SH3_1-1wxbA01

A:11-56

Gene Ontology (13, 13)

NMR Structure(hide GO term definitions)

Chain A (ES8L2_HUMAN | Q9H6S3)

molecular function
	GO:0030676	Rac guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rac family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005089	Rho guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
biological process
	GO:0007266	Rho protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Rho family of proteins switching to a GTP-bound active state.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:1900029	positive regulation of ruffle assembly	Any process that activates or increases the frequency, rate or extent of ruffle assembly.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.
	GO:0031982	vesicle	Any small, fluid-filled, spherical organelle enclosed by membrane.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wxb)

	Sites
(no "Sites" information available for 1wxb)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wxb)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1wxb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ES8L2_HUMAN \| Q9H6S3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ES8L2_HUMAN \| Q9H6S3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	ES8L2_HUMAN \| Q9H6S3	:	1wwu

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WXB)