|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WWN) |
Sites (0, 0)| (no "Site" information available for 1WWN) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WWN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WWN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WWN) |
Exons (0, 0)| (no "Exon" information available for 1WWN) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:69 aligned with SIX1_MESMA | O61668 from UniProtKB/Swiss-Prot Length:88 Alignment length:69 28 38 48 58 68 78 SIX1_MESMA 19 KKNGYAVDSSGKVSECLLNNYCNNICTKVYYATSGYCCLLSCYCFGLDDDKAVLKIKDATKSYCDVQII 87 SCOP domains d1wwna_ A: automated matches SCOP domains CATH domains 1wwnA00 A:1-69 [code=3.30.30.10, no name defined] CATH domains Pfam domains -Toxin_3-1wwnA01 A:2-51 ------------------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------- Transcript 1wwn A 1 KKNGYAVDSSGKVSECLLNNYCNNICTKVYYATSGYCCLLSCYCFGLDDDKAVLKIKDATKSYCDVQII 69 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (SIX1_MESMA | O61668)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|