|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1WTU) |
(no "Site" information available for 1WTU) |
(no "SS Bond" information available for 1WTU) |
(no "Cis Peptide Bond" information available for 1WTU) |
(no "SAP(SNP)/Variant" information available for 1WTU) |
NMR Structure (1, 2)
|
(no "Exon" information available for 1WTU) |
NMR StructureChain A from PDB Type:PROTEIN Length:99 aligned with TF1_BPSP1 | P04445 from UniProtKB/Swiss-Prot Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 TF1_BPSP1 1 MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVKPGESLKKAAEGLKYEDFAK 99 SCOP domains d1wtua_ A: Transcription factor 1, TF1 SCOP domains CATH domains 1wtuA00 A:1-99 HU Protein, subunit A CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------HISTONE_LIKE ---------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 1wtu A 1 MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVKPGESLKKAAEGLKYEDFAK 99 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:99 aligned with TF1_BPSP1 | P04445 from UniProtKB/Swiss-Prot Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 TF1_BPSP1 1 MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVKPGESLKKAAEGLKYEDFAK 99 SCOP domains d1wtub_ B: Transcription factor 1, TF1 SCOP domains CATH domains 1wtuB00 B:1-99 HU Protein, subunit A CATH domains Pfam domains (1) Bac_DNA_binding-1wtuB01 B:1-90 --------- Pfam domains (1) Pfam domains (2) Bac_DNA_binding-1wtuB02 B:1-90 --------- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------HISTONE_LIKE ---------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 1wtu B 1 MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVKPGESLKKAAEGLKYEDFAK 99 10 20 30 40 50 60 70 80 90
|
NMR Structure
|
NMR Structure
|
NMR Structure |
NMR Structure(hide GO term definitions) Chain A,B (TF1_BPSP1 | P04445)
|
|
|
|
|
|
|