|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (0, 0)| (no "Site" information available for 1WQ9) |
SS Bonds (8, 8)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WQ9) |
PROSITE Motifs (2, 4)
Asymmetric/Biological Unit (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WQ9) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:96 aligned with TXVE_DABRR | P67861 from UniProtKB/Swiss-Prot Length:144 Alignment length:96 34 44 54 64 74 84 94 104 114 TXVE_DABRR 25 QVRPFLDVYERSACQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACECRPR 120 SCOP domains d1wq9a_ A: Vascular endothelial growth factor, VEGF SCOP domains CATH domains 1wq9A00 A:1-96 Cystine-knot cytokines CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) PDGF_2 PDB: A:2-95 UniProt: 25-122 PROSITE (1) PROSITE (2) ------------------------------------PDGF_1 ----------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------ Transcript 1wq9 A 1 EVRPFLDVYQRSACQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACECRPA 96 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:96 aligned with TXVE_DABRR | P67861 from UniProtKB/Swiss-Prot Length:144 Alignment length:96 34 44 54 64 74 84 94 104 114 TXVE_DABRR 25 QVRPFLDVYERSACQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACECRPR 120 SCOP domains d1wq9b_ B: Vascular endothelial growth factor, VEGF SCOP domains CATH domains -1wq9B00 B:2-96 Cystine-knot cytokines CATH domains Pfam domains (1) -------------PDGF-1wq9B01 B:14-71 ------------------------- Pfam domains (1) Pfam domains (2) -------------PDGF-1wq9B02 B:14-71 ------------------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) PDGF_2 PDB: B:2-95 UniProt: 25-122 PROSITE (1) PROSITE (2) ------------------------------------PDGF_1 ----------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------ Transcript 1wq9 B 1 xVRPFLDVYQRSACQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACECRPA 96 | 10 20 30 40 50 60 70 80 90 1-PCA
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)| Asymmetric/Biological Unit |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (TXVE_DABRR | P67861)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|