|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WMT) |
Sites (0, 0)| (no "Site" information available for 1WMT) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WMT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WMT) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WMT) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:41 aligned with KAX6B_OPIMA | P0C194 from UniProtKB/Swiss-Prot Length:63 Alignment length:41 31 41 51 61 KAX6B_OPIMA 22 VHTNIPCRGTSDCYEPCEKKYNCARAKCMNRHCNCYNNCPW 62 SCOP domains d1wmta_ A: Istx SCOP domains CATH domains 1wmtA00 A:1-41 CATH domains Pfam domains ----Toxin_2-1wmtA01 A:5-36 ----- Pfam domains SAPs(SNPs) ----------------------------------------- SAPs(SNPs) PROSITE ------------SCORP_SHORT_TOXIN ------ PROSITE Transcript ----------------------------------------- Transcript 1wmt A 1 VHTNIPCRGTSDCYEPCEKKYNCARAKCMNRHCNCYNNCPW 41 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (KAX6B_OPIMA | P0C194)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|