|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WMI) |
Sites (0, 0)| (no "Site" information available for 1WMI) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WMI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WMI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WMI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WMI) |
Exons (0, 0)| (no "Exon" information available for 1WMI) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:88 aligned with O73966_PYRHO | O73966 from UniProtKB/TrEMBL Length:90 Alignment length:88 10 20 30 40 50 60 70 80 O73966_PYRHO 1 MTYRVKIHKQVVKALQSLPKAHYRRFLEFRDILEYEPVPREKFDVIKLEGTGDLDLYRARLGDYRVIYSVNWKDKVIKILKLKPRGRA 88 SCOP domains d1wmia1 A:1-88 Hypothetical protein PHS013 SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 1wmi A 1 MTYRVKIHKQVVKALQSLPKAHYRRFLEFRDILEYEPVPREKFDVIKLEGTGDLDLYRARLGDYRVIYSVNWKDKVIKILKLKPRGRA 88 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:61 aligned with O73967_PYRHO | O73967 from UniProtKB/TrEMBL Length:67 Alignment length:61 16 26 36 46 56 66 O73967_PYRHO 7 GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPED 67 SCOP domains d1wmib1 B:7-67 Hypothetical protein PHS014 SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 1wmi B 7 GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPED 67 16 26 36 46 56 66 Chain C from PDB Type:PROTEIN Length:88 aligned with O73966_PYRHO | O73966 from UniProtKB/TrEMBL Length:90 Alignment length:88 10 20 30 40 50 60 70 80 O73966_PYRHO 1 MTYRVKIHKQVVKALQSLPKAHYRRFLEFRDILEYEPVPREKFDVIKLEGTGDLDLYRARLGDYRVIYSVNWKDKVIKILKLKPRGRA 88 SCOP domains d1wmic_ C: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains (1) --Plasmid_stabil-1wmiC01 C:3-88 Pfam domains (1) Pfam domains (2) --Plasmid_stabil-1wmiC02 C:3-88 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 1wmi C 1 MTYRVKIHKQVVKALQSLPKAHYRRFLEFRDILEYEPVPREKFDVIKLEGTGDLDLYRARLGDYRVIYSVNWKDKVIKILKLKPRGRA 88 10 20 30 40 50 60 70 80 Chain D from PDB Type:PROTEIN Length:61 aligned with O73967_PYRHO | O73967 from UniProtKB/TrEMBL Length:67 Alignment length:61 16 26 36 46 56 66 O73967_PYRHO 7 GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPED 67 SCOP domains d1wmid_ D: automated matches SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 1wmi D 7 GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPED 67 16 26 36 46 56 66
|
||||||||||||||||||||
SCOP Domains (4, 4)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WMI) |
Pfam Domains (1, 2)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1WMI)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|