1WJ3 - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE FOURTH FN3 DOMAIN OF KIAA1496 PROTEIN

Authors :   K. Inoue, T. Nagashima, N. Tochio, T. Kigawa, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   28 May 04 (Deposition) - 28 Nov 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Beta Sandwich, Pang, Kiaa1496 Protein, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Neuropeptide (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Inoue, T. Nagashima, N. Tochio, T. Kigawa, F. Hayashi, S. Yokoyama
Solution Structure Of The Fourth Fn3 Domain Of Kiaa1496 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - KIAA1496 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P030728-76
	Expression System Vector Type	:	PLASMID
	Fragment	:	FN3 DOMAIN
	Gene	:	KAZUSA CDNA FJ09513
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	PLASMACYTOMA-ASSOCIATED NEURONAL GLYCOPROTEIN

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WJ3)

Sites (0, 0)

(no "Site" information available for 1WJ3)

SS Bonds (0, 0)

(no "SS Bond" information available for 1WJ3)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1WJ3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 1WJ3)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	CNTN3_HUMAN	600-698 703-800 805-901 902-998	1	- - - A:17-111

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000263665	1	ENSE00001498194	chr3:74570291-74570209	83	CNTN3_HUMAN	1-19	19	0	-	-
1.2	ENST00000263665	2	ENSE00001498193	chr3:74548936-74548810	127	CNTN3_HUMAN	19-61	43	0	-	-
1.3	ENST00000263665	3	ENSE00001430676	chr3:74535782-74535607	176	CNTN3_HUMAN	61-120	60	0	-	-
1.4	ENST00000263665	4	ENSE00001244237	chr3:74474091-74473996	96	CNTN3_HUMAN	120-152	33	0	-	-
1.5	ENST00000263665	5	ENSE00001244222	chr3:74420550-74420347	204	CNTN3_HUMAN	152-220	69	0	-	-
1.6	ENST00000263665	6	ENSE00001680603	chr3:74419142-74419040	103	CNTN3_HUMAN	220-254	35	0	-	-
1.7	ENST00000263665	7	ENSE00001204236	chr3:74418524-74418340	185	CNTN3_HUMAN	254-316	63	0	-	-
1.8	ENST00000263665	8	ENSE00000966963	chr3:74414853-74414717	137	CNTN3_HUMAN	316-361	46	0	-	-
1.9	ENST00000263665	9	ENSE00001142855	chr3:74413747-74413618	130	CNTN3_HUMAN	362-405	44	0	-	-
1.10	ENST00000263665	10	ENSE00000773982	chr3:74411191-74411041	151	CNTN3_HUMAN	405-455	51	0	-	-
1.11	ENST00000263665	11	ENSE00000773981	chr3:74385809-74385682	128	CNTN3_HUMAN	455-498	44	0	-	-
1.12	ENST00000263665	12	ENSE00000773980	chr3:74384061-74383886	176	CNTN3_HUMAN	498-556	59	0	-	-
1.13	ENST00000263665	13	ENSE00000773979	chr3:74351958-74351841	118	CNTN3_HUMAN	557-596	40	0	-	-
1.14	ENST00000263665	14	ENSE00000773978	chr3:74350956-74350798	159	CNTN3_HUMAN	596-649	54	0	-	-
1.15	ENST00000263665	15	ENSE00000773977	chr3:74350698-74350549	150	CNTN3_HUMAN	649-699	51	0	-	-
1.16	ENST00000263665	16	ENSE00001244155	chr3:74349089-74349019	71	CNTN3_HUMAN	699-722	24	0	-	-
1.17	ENST00000263665	17	ENSE00000773974	chr3:74347342-74347108	235	CNTN3_HUMAN	723-801	79	0	-	-
1.18	ENST00000263665	18	ENSE00000773973	chr3:74344387-74344272	116	CNTN3_HUMAN	801-839	39	0	-	-
1.19	ENST00000263665	19	ENSE00000773972	chr3:74334642-74334456	187	CNTN3_HUMAN	840-902	63	1	A:1-17 (gaps)	20
1.20b	ENST00000263665	20b	ENSE00000773971	chr3:74316529-74316417	113	CNTN3_HUMAN	902-939	38	1	A:17-54	38
1.21	ENST00000263665	21	ENSE00000773970	chr3:74315800-74315632	169	CNTN3_HUMAN	940-996	57	1	A:55-111	57
1.22b	ENST00000263665	22b	ENSE00001244229	chr3:74313652-74311719	1934	CNTN3_HUMAN	996-1028	33	1	A:111-117 (gaps)	10

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:117
 aligned with CNTN3_HUMAN | Q9P232 from UniProtKB/Swiss-Prot  Length:1028

    Alignment length:123
                                   892       902       912       922       932       942       952       962       972       982       992      1002   
         CNTN3_HUMAN    883 NSAGAGPFSATVNVTTKKTPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSMDARGSTSA 1005
               SCOP domains d1wj3   a_ A: Contactin 3 (KIAA1496)                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------fn3-1wj3A01 A:19-101                                                               ------------------- Pfam domains
         Sec.struct. author .....---.......................ee..eeeee............eeeeeeeeee......eeeee...eeeee......eeeeeeeee..........eee......---..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE FN3  PDB: -        FN3  PDB: A:17-111 UniProt: 902-998                                                              ------- PROSITE
           Transcript 1 (1) Exon 1.19           -------------------------------------Exon 1.21  PDB: A:55-111 UniProt: 940-996                --------- Transcript 1 (1)
           Transcript 1 (2) -------------------Exon 1.20b  PDB: A:17-54              --------------------------------------------------------Exon 1.22b Transcript 1 (2)
                1wj3 A    1 GSSGS---SGTVNVTTKKTPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSS---GPSSG  117
                                |   |7        17        27        37        47        57        67        77        87        97       107    |  114   
                                5   6                                                                                                       112 113

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Immunoglobulin-like beta-sandwich (7299)

Superfamily: Fibronectin type III (212)

Family: Fibronectin type III (180)

Protein domain: Contactin 3 (KIAA1496) (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d1wj3a_

CATH Domains (0, 0)

(no "CATH Domain" information available for 1WJ3)

Pfam Domains (1, 1)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: E-set (290)

Family: fn3 (66)

Homo sapiens (Human) (52)

fn3-1wj3A01

A:19-101

Gene Ontology (5, 5)

NMR Structure(hide GO term definitions)

Chain A (CNTN3_HUMAN | Q9P232)

biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
cellular component
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wj3)

	Sites
(no "Sites" information available for 1wj3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wj3)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1wj3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CNTN3_HUMAN \| Q9P232
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CNTN3_HUMAN \| Q9P232
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File