1WHO - JenaLib

Biol.Unit 1 - manually

Asymmetric Unit

Biological Unit 1

collapse

expand

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Description

Title :   ALLERGEN PHL P 2

Authors :   A. A. Fedorov, E. V. Fedorov, C. Dolecek, M. Susani, R. Valenta, S. C. Almo

Date :   04 Apr 97 (Deposition) - 07 Jul 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Timothy Grass Pollen Allergen, Allergen (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. A. Fedorov, E. V. Fedorov, C. Dolecek, M. Susani, R. Valenta, S. C. Almo
Crystal Structure Of Phl P 2, A Major Timothy Grass (Phleum Pratense) Pollen Allergen
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - ALLERGEN PHL P 2
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	TIMOTHY GRASS
	Organism Scientific	:	PHLEUM PRATENSE
	Organism Taxid	:	15957
	Synonym	:	PHL P II

Structural Features

Chains, Units

		1
Asymmetric Unit	:	A
Biological Unit 1 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WHO)

Sites (0, 0)

(no "Site" information available for 1WHO)

SS Bonds (0, 0)

(no "SS Bond" information available for 1WHO)

Cis Peptide Bonds (1, 1)

Asymmetric Unit

No.	Residues
1	Gly A:62	-	Pro A:63

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 1WHO)

PROSITE Motifs (1, 1)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EXPANSIN_CBD	PS50843	Expansin, Cellulose-binding-like domain profile.	MPAP2_PHLPR	41-120	1	A:15-94

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EXPANSIN_CBD	PS50843	Expansin, Cellulose-binding-like domain profile.	MPAP2_PHLPR	41-120	2	A:15-94

Exons (0, 0)

(no "Exon" information available for 1WHO)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:94
 aligned with MPAP2_PHLPR | P43214 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:94
                                    36        46        56        66        76        86        96       106       116    
          MPAP2_PHLPR    27 VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP 120
               SCOP domains d1whoa_ A: PHL P 2                                                                             SCOP domains
               CATH domains 1whoA00 A:1-94  [code=2.60.40.760, no name defined]                                            CATH domains
               Pfam domains ---Pollen_allerg_1-1whoA01 A:4-83                                                  ----------- Pfam domains
         Sec.struct. author ....eeeee.......eeeeee.......eeeeeee.....eeeeee...eeee........eeeeeeee...eeeee...........eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------EXPANSIN_CBD  PDB: A:15-94 UniProt: 41-120                                       PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 1who A   1 VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP  94
                                    10        20        30        40        50        60        70        80        90

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: C2 domain-like (198)

Superfamily: PHL pollen allergen (9)

Family: PHL pollen allergen (5)

Protein domain: PHL P 2 (3)

Timothy grass (Phleum pratense) [TaxId: 15957] (3)

d1whoa_

CATH Domains (1, 1)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: [code=2.60.40.760, no name defined] (5)

Timothy grass (Phleum pratense) (4)

1whoA00

A:1-94

Pfam Domains (1, 1)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Pollen_allerg_1] (5)

Family: Pollen_allerg_1 (5)

Phleum pratense (Common timothy) (5)

Pollen_allerg_1-1whoA01

A:4-83

Gene Ontology (1, 1)

Asymmetric Unit(hide GO term definitions)

Chain A (MPAP2_PHLPR | P43214)

cellular component
	GO:0005576		extracellular region		The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1who)

	Sites
(no "Sites" information available for 1who)

	Cis Peptide Bonds
		Gly A:62 - Pro A:63	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1who
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MPAP2_PHLPR \| P43214
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MPAP2_PHLPR \| P43214
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	MPAP2_PHLPR \| P43214	:	1bmw 1whp 2vxq

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WHO)