|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WF9) |
Sites (0, 0)| (no "Site" information available for 1WF9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WF9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WF9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WF9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WF9) |
Exons (0, 0)| (no "Exon" information available for 1WF9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:107 aligned with NPL41_ARATH | Q9LYC2 from UniProtKB/Swiss-Prot Length:413 Alignment length:110 96 1 95 | | 4 14 24 34 44 54 64 74 84 94| | 103 NPL41_ARATH - ------MTMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGSMVYLAYEGERTIRG-GPAVTPAG 103 SCOP domains -------d1wf9a1 A:8-101 NPL4-like protein 1 --------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------UN_NPL4-1wf9A01 A:8-94 ---------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1wf9 A 1 GSSGSSGTMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGSMVYLAYEGERTIRGSGPS---SG 107 10 20 30 40 50 60 70 80 90 100 | 107 105 106
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WF9) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (NPL41_ARATH | Q9LYC2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|