Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF BANNAVIRUS VP9
 
Authors :  F. M. Jaafar, H. Attoui, M. W. Bahar, C. Siebold, G. Sutton, P. P. C. Mertens, P. Micco, D. I. Stuart, J. M. Grimes, X. Lamballerie
Date :  21 Oct 04  (Deposition) - 01 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Virus Coat Protein, Dsrna Virus, Outer Core Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. M. Jaafar, H. Attoui, M. W. Bahar, C. Siebold, G. Sutton, P. P. C. Mertens, P. De Micco, D. I. Stuart, J. M. Grimes, X. De Lamballerie
The Structure And Function Of The Outer Coat Protein Vp9 Of Banna Virus
Structure V. 13 17 2005
PubMed-ID: 15642258  |  Reference-DOI: 10.1016/J.STR.2004.10.017

(-) Compounds

Molecule 1 - VP9
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PGEX-4T-2
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Variant: BL-CODONPLUS(DE3)-RP-X
    Organism Scientific: BANNA VIRUS
    Organism Taxid: 77763
    Strain: BAV-CH
    Synonym: BANNAVIRUS VP9

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1W9Z)

(-) Sites  (0, 0)

(no "Site" information available for 1W9Z)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1W9Z)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1W9Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1W9Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1W9Z)

(-) Exons   (0, 0)

(no "Exon" information available for 1W9Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:257
 aligned with Q9YWN5_9REOV | Q9YWN5 from UniProtKB/TrEMBL  Length:283

    Alignment length:257
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       
         Q9YWN5_9REOV    27 ALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP 283
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhh.hhhhhhhh.........hhhhhhhh...hhhhhhhhhhhhh.........ee......eee.....eee.eeeee..eeeeeeee............eeeeeeeeee....eeeeeeeeeeeeee..........eeeeeeeee.hhhhhh.eeee....hhhhhhhhhhhh..hhhh.....eeee.......ee................eeeeeeee.hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1w9z A  27 ALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP 283
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       


Chain B from PDB  Type:PROTEIN  Length:257
 aligned with Q9YWN5_9REOV | Q9YWN5 from UniProtKB/TrEMBL  Length:283

    Alignment length:257
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       
         Q9YWN5_9REOV    27 ALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP 283
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhh.hhhhhhhh.........hhhhhhhhh..hhhhhhhhhhhhh.........ee......eee.....eee.eeeee..eeeeeeee............eeeeeeeee......eeeeeeeeeeeee..........eeeeeeeee.hhhhhh.eeee....hhhhhhhhhhhh..hhhh.....eeee.......ee................eeeeeeee.hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1w9z B  27 ALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP 283
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       


Chain C from PDB  Type:PROTEIN  Length:254
 aligned with Q9YWN5_9REOV | Q9YWN5 from UniProtKB/TrEMBL  Length:283

    Alignment length:254
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279    
         Q9YWN5_9REOV    30 SNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP 283
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Reoviridae_Vp9-1w9zC01 C:30-280                                                                                                                                                                                                                            --- Pfam domains (1)
           Pfam domains (2) Reoviridae_Vp9-1w9zC02 C:30-280                                                                                                                                                                                                                            --- Pfam domains (2)
           Pfam domains (3) Reoviridae_Vp9-1w9zC03 C:30-280                                                                                                                                                                                                                            --- Pfam domains (3)
         Sec.struct. author .....hhhhhhhhh.hhhhhhhhhh.......hhhhhhh....hhhhhhhhhhhhh.........ee......eee.....eee.eeeee..eeeeeeee............eeeeeeeee......eeeeeeeeeeeee..........eeeeeeeee.hhhhhh.eeee....hhhhhhhhhhhh..hhhh.....eeee.......ee................eeeeeeee.hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1w9z C  30 SNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP 283
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1W9Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1W9Z)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Reoviridae_Vp9] (1)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1W9Z)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1w9z)
 
  Sites
(no "Sites" information available for 1w9z)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1w9z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1w9z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9YWN5_9REOV | Q9YWN5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9YWN5_9REOV | Q9YWN5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1W9Z)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1W9Z)