|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 1W8I) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1W8I) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1W8I) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1W8I) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1W8I) |
Exons (0, 0)| (no "Exon" information available for 1W8I) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:155 aligned with Y1683_ARCFU | O28590 from UniProtKB/Swiss-Prot Length:156 Alignment length:155 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 Y1683_ARCFU 1 MAALIDTGIFFGFYSLKDVHHMDSVAIVVHAVEGKWGRLFVTNHILDETLTLLKYKKLPADKFLEGFVESGVLNIIYTDDEVERKALEVFKARVYEKGFSYTDAISEVVAEELKLKLISYDSRFSLPTIGRDYWKSLDESERKRISAILREKGID 155 SCOP domains d1w8ia_ A: Hypothetical protein AF1683 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --PIN-1w8iA01 A:3-129 -------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1w8i A 1 mAALIDTGIFFGFYSLKDVHHmDSVAIVVHAVEGKWGRLFVTNHILDETLTLLKYKKLPADKFLEGFVESGVLNIIYTDDEVERKALEVFKARVYEKGFSYTDAISEVVAEELKLKLISYDSRFSLPTIGRDYWKSLDESERKRISAILREKGID 155 | 10 20 | 30 40 50 60 70 80 90 100 110 120 130 140 150 | 22-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1W8I) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (Y1683_ARCFU | O28590)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|