|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1W09) |
Sites (0, 0)| (no "Site" information available for 1W09) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1W09) |
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1W09) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1W09) |
Exons (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:92 aligned with AHSP_HUMAN | Q9NZD4 from UniProtKB/Swiss-Prot Length:102 Alignment length:92 12 22 32 42 52 62 72 82 92 AHSP_HUMAN 3 LLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHEL 94 SCOP domains d1w09a_ A: Alpha-hemoglobin stabilizing protein AHSP SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains --AHSP-1w09A01 A:5-93 - Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.2 PDB: A:3-25 Exon 1.3 PDB: A:26-94 UniProt: 26-102 [INCOMPLETE] Transcript 1 1w09 A 3 LLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHEL 94 12 22 32 42 52 62 72 82 92
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1W09) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (10, 10)|
NMR Structure(hide GO term definitions) Chain A (AHSP_HUMAN | Q9NZD4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|