|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)
Asymmetric Unit (2, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VQ2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1VQ2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VQ2) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1VQ2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:173 aligned with DCTD_BPT4 | P16006 from UniProtKB/Swiss-Prot Length:193 Alignment length:193 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 DCTD_BPT4 1 MKASTVLQIAYLVSQESKCCSWKVGAVIEKNGRIISTGYNGSPAGGVNCCDYAAEQGWLLNKPKHAIIQGHKPECVSFGSTDRFVLAKEHRSAHSEWSSKNEIHAELNAILFAARNGSSIEGATMYVTLSPCPDCAKAIAQSGIKKLVYCETYDKNKPGWDDILRNAGIEVFNVPKKNLNKLNWENINEFCGE 193 SCOP domains d1vq2a_ A: Deoxycytidylate deaminase SCOP domains CATH domains 1vq2A00 A:1-193 Cytidine Deaminase, domain 2 CATH domains Pfam domains dCMP_cyt_deam_1-1vq2A01 A:1-151 ------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) CYT_DCMP_DEAMINASES_2 PDB: A:1-171 UniProt: 1-171 ---------------------- PROSITE (1) PROSITE (2) -------------------------------------------------------------------------------------------------------CYT_DCMP_DEAMINASES_1 PDB: A:104-13------------------------------------------------------ PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1vq2 A 1 MKASTVLQIAYLVSQESKCCSWKVGAVIEKNGRIISTGYNGSPAGGVNCCDYAAEQGWLLNK--------------------RFVLAKEHRSAHSEWSSKNEIHAELNAILFAAENGSSIEGATMYVTLSPCPDCAKAIAQSGIKKLVYCETYDKNKPGWDDILRNAGIEVFNVPKKNLNKLNWENINEFCGE 193 10 20 30 40 50 60 | - - | 90 100 110 120 130 140 150 160 170 180 190 62 83
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (DCTD_BPT4 | P16006)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|