Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GENE PRODUCT OF AT1G24000 FROM ARABIDOPSIS THALIANA
 
Authors :  G. E. Wesenberg, D. W. Smith, G. N. Phillips Jr. , K. A. Johnson, C. A. Bingman, Center For Eukaryotic Structural Genomics (Cesg
Date :  20 Feb 04  (Deposition) - 16 Mar 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Arabidopsis Thaliana, Center For Eukaryotic Structural Genomics, Protein Structure Initiative, Cesg, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Song, Q. Zhao, M. S. Lee, J. L. Markley
1H, 15N And 13C Resonance Assignments Of The Putative Bet V 1 Family Protein At1G24000. 1 From Arabidopsis Thaliana.
J. Biomol. Nmr V. 32 335 2005
PubMed-ID: 16211487  |  Reference-DOI: 10.1007/S10858-005-8205-4
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BET V I ALLERGEN FAMILY
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneAT1G24000
    Organism CommonTHALE CRESS
    Organism ScientificARABIDOPSIS THALIANA
    Organism Taxid3702

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1VJH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VJH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VJH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VJH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1VJH)

(-) Exons   (0, 0)

(no "Exon" information available for 1VJH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:120
 aligned with Y1400_ARATH | P0C0B0 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:120
                                    10        20        30        40        50        60        70        80        90       100       110       120
          Y1400_ARATH     1 MTLKGALSVKFDVKCPADKFFSAFVEDTNRPFEKNGKTEIEAVDLVKKTMTIQMSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKDIDDPHSIIDESVKYFKKLDEAILNF 120
               SCOP domains d1vjha_ A: Hypothetical protein At1G24000                                                                                SCOP domains
               CATH domains 1vjhA00 A:1-120  [code=3.30.530.20, no name defined]                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeeeeee..hhhhhhhhhhhhh........eeeeeeee....eeeeeee..hhhh.eeeeeeeeeeee......eeeeeeeeeee.......hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vjh A   1 STLKGALSVKFDVKCPADKFFSAFVEDTNRPFEKNGKTEIEAVDLVKKTmTIQmSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKDIDDPHSIIDESVKYFKKLDEAILNF 120
                                    10        20        30        40        50   |    60        70        80        90       100       110       120
                                                                            50-MSE                                                                  
                                                                                54-MSE                                                              

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with Y1400_ARATH | P0C0B0 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:120
                                    10        20        30        40        50        60        70        80        90       100       110       120
          Y1400_ARATH     1 MTLKGALSVKFDVKCPADKFFSAFVEDTNRPFEKNGKTEIEAVDLVKKTMTIQMSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKDIDDPHSIIDESVKYFKKLDEAILNF 120
               SCOP domains d1vjhb_ B: Hypothetical protein At1G24000                                                                                SCOP domains
               CATH domains 1vjhB00 B:1-120  [code=3.30.530.20, no name defined]                                                                     CATH domains
           Pfam domains (1) -------------------------------Bet_v_1-1vjhB01 B:32-119                                                                - Pfam domains (1)
           Pfam domains (2) -------------------------------Bet_v_1-1vjhB02 B:32-119                                                                - Pfam domains (2)
         Sec.struct. author ...eeeeeeeeee..hhhhhhhhhhhhh........eeeeeeee....eeeeeee..hhhh.eeeeeeeeeeee......eeeeeeeeeee.......hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vjh B   1 STLKGALSVKFDVKCPADKFFSAFVEDTNRPFEKNGKTEIEAVDLVKKTmTIQmSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKDIDDPHSIIDESVKYFKKLDEAILNF 120
                                    10        20        30        40        50   |    60        70        80        90       100       110       120
                                                                            50-MSE                                                                  
                                                                                54-MSE                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (4, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Y1400_ARATH | P0C0B0)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009607    response to biotic stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a biotic stimulus, a stimulus caused or produced by a living organism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1vjh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vjh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vjh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ML423_ARATH | Q93VR4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  Y1400_ARATH | P0C0B0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  Y1401_ARATH | P0C0B1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ML423_ARATH | Q93VR4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Y1400_ARATH | P0C0B0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Y1401_ARATH | P0C0B1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Y1400_ARATH | P0C0B02q3q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VJH)