1VIH - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   NMR STUDY OF VIGILIN, REPEAT 6, MINIMIZED AVERAGE STRUCTURE

Authors :   G. Musco, G. Stier, C. Joseph, M. A. C. Morelli, M. Nilges, T. J. Gibson, A. Pastore

Date :   29 Nov 95 (Deposition) - 03 Apr 96 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A

Keywords :   Rna-Binding Protein, Ribonucleoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Musco, G. Stier, C. Joseph, M. A. Castiglione Morelli, M. Nilges, T. J. Gibson, A. Pastore
Three-Dimensional Structure And Stability Of The Kh Domain: Molecular Insights Into The Fragile X Syndrome.
Cell(Cambridge, Mass. ) V. 85 237 1996
PubMed-ID: 8612276 | Reference-DOI: 10.1016/S0092-8674(00)81100-9
(for further references see the PDB file header)

Molecule 1 - VIGILIN
	Cell Line	:	BL21
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Gene	:	HUMAN VIGILIN SIXTH KH REPEAT
	Expression System Plasmid	:	PET9D
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Fragment	:	KH6, RESIDUES 432 TO 501
	Gene	:	HUMAN VIGILIN SIXTH KH REPEAT
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	N-TERMINAL 6-HISTIDINE FUSION PROTEIN YES


NMR Structure	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1VIH)

(no "Site" information available for 1VIH)

(no "SS Bond" information available for 1VIH)

(no "Cis Peptide Bond" information available for 1VIH)

(no "SAP(SNP)/Variant" information available for 1VIH)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	KH_TYPE_1	PS50084	Type-1 KH domain profile.	VIGLN_HUMAN	150-212 295-357 222-284 364-424 435-497 507-570 581-643 653-716 727-790 800-863 873-967 972-1034 1052-1117 1127-1190	1	- - - - A:9-71 - - - - - - - - -

NMR Structure (2, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000391976	3a	ENSE00001551528	chr2:242254707-242254517	191	VIGLN_HUMAN	-	0	0	-	-
1.10c	ENST00000391976	10c	ENSE00001381224	chr2:242207956-242207892	65	VIGLN_HUMAN	-	0	0	-	-
1.12f	ENST00000391976	12f	ENSE00002183442	chr2:242206321-242206209	113	VIGLN_HUMAN	1-26	26	0	-	-
1.14e	ENST00000391976	14e	ENSE00001762971	chr2:242204020-242203863	158	VIGLN_HUMAN	26-78	53	0	-	-
1.15i	ENST00000391976	15i	ENSE00001743253	chr2:242202341-242202126	216	VIGLN_HUMAN	79-150	72	0	-	-
1.16c	ENST00000391976	16c	ENSE00001796682	chr2:242196221-242196015	207	VIGLN_HUMAN	151-219	69	0	-	-
1.17c	ENST00000391976	17c	ENSE00001605751	chr2:242195814-242195599	216	VIGLN_HUMAN	220-291	72	0	-	-
1.18b	ENST00000391976	18b	ENSE00000787283	chr2:242194995-242194789	207	VIGLN_HUMAN	292-360	69	0	-	-
1.18h	ENST00000391976	18h	ENSE00000787284	chr2:242194573-242194466	108	VIGLN_HUMAN	361-396	36	0	-	-
1.19	ENST00000391976	19	ENSE00000787285	chr2:242192912-242192808	105	VIGLN_HUMAN	397-431	35	0	-	-
1.20c	ENST00000391976	20c	ENSE00000787286	chr2:242192450-242192372	79	VIGLN_HUMAN	432-458	27	1	A:6-32	27
1.21c	ENST00000391976	21c	ENSE00000787287	chr2:242189395-242189256	140	VIGLN_HUMAN	458-504	47	1	A:32-76	45
1.23c	ENST00000391976	23c	ENSE00000787288	chr2:242187763-242187659	105	VIGLN_HUMAN	505-539	35	0	-	-
1.24a	ENST00000391976	24a	ENSE00000787289	chr2:242187531-242187418	114	VIGLN_HUMAN	540-577	38	0	-	-
1.25b	ENST00000391976	25b	ENSE00000787290	chr2:242186557-242186471	87	VIGLN_HUMAN	578-606	29	0	-	-
1.26a	ENST00000391976	26a	ENSE00000787291	chr2:242186298-242186167	132	VIGLN_HUMAN	607-650	44	0	-	-
1.28b	ENST00000391976	28b	ENSE00000787292	chr2:242182093-242181875	219	VIGLN_HUMAN	651-723	73	0	-	-
1.29d	ENST00000391976	29d	ENSE00000787294	chr2:242179537-242179316	222	VIGLN_HUMAN	724-797	74	0	-	-
1.30b	ENST00000391976	30b	ENSE00000787296	chr2:242179235-242179017	219	VIGLN_HUMAN	798-870	73	0	-	-
1.31b	ENST00000391976	31b	ENSE00000787298	chr2:242178202-242178064	139	VIGLN_HUMAN	871-917	47	0	-	-
1.32b	ENST00000391976	32b	ENSE00000787300	chr2:242176184-242176030	155	VIGLN_HUMAN	917-968	52	0	-	-
1.33b	ENST00000391976	33b	ENSE00000787302	chr2:242175009-242174905	105	VIGLN_HUMAN	969-1003	35	0	-	-
1.33g	ENST00000391976	33g	ENSE00000787304	chr2:242174670-242174536	135	VIGLN_HUMAN	1004-1048	45	0	-	-
1.34b	ENST00000391976	34b	ENSE00000787306	chr2:242173378-242173235	144	VIGLN_HUMAN	1049-1096	48	0	-	-
1.35c	ENST00000391976	35c	ENSE00002161677	chr2:242170359-242170174	186	VIGLN_HUMAN	1097-1158	62	0	-	-
1.36b	ENST00000391976	36b	ENSE00001636515	chr2:242169684-242169568	117	VIGLN_HUMAN	1159-1197	39	0	-	-
1.36g	ENST00000391976	36g	ENSE00001642879	chr2:242169376-242169248	129	VIGLN_HUMAN	1198-1240	43	0	-	-
1.36l	ENST00000391976	36l	ENSE00001556167	chr2:242169102-242168627	476	VIGLN_HUMAN	1241-1268	28	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:71
 aligned with VIGLN_HUMAN | Q00341 from UniProtKB/Swiss-Prot  Length:1268

    Alignment length:71
                                   441       451       461       471       481       491       501 
          VIGLN_HUMAN   432 INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS 502
               SCOP domains d1viha_ A: Vigilin                                                      SCOP domains
               CATH domains 1vihA00 A:6-76  [code=3.30.1370.10, no name defined]                    CATH domains
               Pfam domains -----KH_1-1vihA01 A:11-71                                         ----- Pfam domains
         Sec.struct. author ....eeeeeee....hhhhh.....hhhhhhhhh..eee........eeeeeee..hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---KH_TYPE_1  PDB: A:9-71 UniProt: 435-497                        ----- PROSITE
           Transcript 1 (1) Exon 1.20c  PDB: A:6-32    -------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.21c  PDB: A:32-76 UniProt: 458-504     Transcript 1 (2)
                 1vih A   6 INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS  76
                                    15        25        35        45        55        65        75

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Eukaryotic type KH-domain (KH-domain type I) (51)

Superfamily: Eukaryotic type KH-domain (KH-domain type I) (51)

Family: Eukaryotic type KH-domain (KH-domain type I) (40)

Protein domain: Vigilin (8)

Human (Homo sapiens) [TaxId: 9606] (8)

d1viha_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Ribosomal Protein S8; Chain: A, domain 1 (139)

Homologous Superfamily: [code=3.30.1370.10, no name defined] (23)

Human (Homo sapiens) (13)

1vihA00

A:6-76

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: KH (43)

Family: KH_1 (21)

Homo sapiens (Human) (17)

KH_1-1vihA01

A:11-71

NMR Structure(hide GO term definitions)

Chain A (VIGLN_HUMAN | Q00341)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008203	cholesterol metabolic process	The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0034364	high-density lipoprotein particle	A lipoprotein particle with a high density (typically 1.063-1.21 g/ml) and a diameter of 5-10 nm that contains APOAs and may contain APOCs and APOE; found in blood and carries lipids from body tissues to the liver as part of the reverse cholesterol transport process.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1vih)

	Sites
(no "Sites" information available for 1vih)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vih)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1vih
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	VIGLN_HUMAN \| Q00341
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	VIGLN_HUMAN \| Q00341
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	VIGLN_HUMAN \| Q00341	:	1vig 2cte 2ctf 2ctj 2ctk 2ctl 2ctm

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (2, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File