1VHS - JenaLib

Title :   CRYSTAL STRUCTURE OF A PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE

Authors :   Structural Genomix

Date :   01 Dec 03 (Deposition) - 30 Dec 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Badger, J. M. Sauder, J. M. Adams, S. Antonysamy, K. Bain, M. G. Bergseid, S. G. Buchanan, M. D. Buchanan, Y. Batiyenko, J. A. Christopher, S. Emtage, A. Eroshkina, I. Feil, E. B. Furlong, K. S. Gajiwala, X. Gao, D. He, J. Hendle, A. Huber, K. Hoda, P. Kearins, C. Kissinger, B. Laubert, H. A. Lewis, J. Lin, K. Loomis, D. Lorimer, G. Louie, M. Maletic, C. D. Marsh, I. Miller, J. Molinari, H. J. Muller-Dieckmann, J. M. Newman, B. W. Noland, B. Pagarigan, F. Park, T. S. Peat, K. W. Post, S. Radojicic, A. Ramos, R. Romero, M. E. Rutter, W. E. Sanderson, K. D. Schwinn, J. Tresser, J. Winhoven, T. A. Wright, L. Wu, J. Xu, T. J. Harris
Structural Analysis Of A Set Of Proteins Resulting From A Bacterial Genomics Project
Proteins V. 60 787 2005
PubMed-ID: 16021622 | Reference-DOI: 10.1002/PROT.20541
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 7)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:165
 aligned with YWNH_BACSU | P71043 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:165
                             1                                                                                                                                                               163 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   | 
           YWNH_BACSU     - -MTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELS-   -
               SCOP domains d1vhsa_ A: Putative phosphinothricin acetyltransferase YwnH                                                                                                           SCOP domains
               CATH domains 1vhsA00 A:0-164  [code=3.40.630.30, no name defined]                                                                                                                  CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhh...........hhhhhhhhhhh......eeeee.....eeeeeeeee...hhhhh.eeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GNAT  PDB: A:2-158 UniProt: 1-158                                                                                                                             ------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vhs A   0 SLTLRLAEHRDLEAVVAIYNSTIASRmVTADTEPVTPEDRmEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLmAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEmDGKRYDLKILGRELSE 164
                                     9        19      | 29        39|       49        59        69        79        89        99       109       119       129       139       149       159     
                                                     26-MSE        40-MSE                                                                      117-MSE                        148-MSE

Chain B from PDB  Type:PROTEIN  Length:158
 aligned with YWNH_BACSU | P71043 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:165
                             1                                                                                                                                                               163 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   | 
           YWNH_BACSU     - -MTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELS-   -
               SCOP domains d1vhsb_ B: Putative phosp       hinothricin acetyltransferase YwnH                                                                                                    SCOP domains
               CATH domains 1vhsB00 B:0-164  [code=3.       40.630.30, no name defined]                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhh-------...hhhhhhhhhhh......eeeee.....eeeeeeeee...hhhhh.eeeeeeee.......hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GNAT  PDB: B:2-158 UniProt: 1-158                                                                                                                             ------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vhs B   0 SLTLRLAEHRDLEAVVAIYNSTIAS-------EPVTPEDRmEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLmAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEmDGKRYDLKILGRELSE 164
                                     9        19    |    -  |     39|       49        59        69        79        89        99       109       119       129       139       149       159     
                                                   24      32      40-MSE                                                                      117-MSE                        148-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (YWNH_BACSU | P71043)

molecular function
	GO:0008080	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
	GO:0004596	peptide alpha-N-acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + peptide = CoA + N-alpha-acetylpeptide. This reaction is the acetylation of the N-terminal amino acid residue of a peptide or protein.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0006474	N-terminal protein amino acid acetylation	The acetylation of the N-terminal amino acid of proteins.
	GO:0046677	response to antibiotic	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
	GO:0031248	protein acetyltransferase complex	A complex that catalyzes the transfer of an acetyl group to a protein acceptor molecule.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1vhs)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vhs)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1vhs
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	YWNH_BACSU \| P71043
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description