Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN ISOZYME OF CITRATE SYNTHASE FROM SULFOLBUS TOKODAII STRAIN7
 
Authors :  M. Murakami, K. Ihara, T. Kouyama
Date :  28 Apr 04  (Deposition) - 28 Jun 05  (Release) - 28 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Open Form, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Murakami, K. Ihara, T. Kouyama
Crystal Structures Of Two Isozymes Of Citrate Synthase From Sulfolbus Tokodaii Strain7
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 373AA LONG HYPOTHETICAL CITRATE SYNTHASE
    Chains: A
    EC Number: 2.3.3.1, 4.1.3.7
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-11A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: STRAIN7
    Organism Scientific: SULFOLOBUS TOKODAII
    Organism Taxid: 111955

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1VGP)

(-) Sites  (0, 0)

(no "Site" information available for 1VGP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VGP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VGP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VGP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1VGP)

(-) Exons   (0, 0)

(no "Exon" information available for 1VGP)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:373
 aligned with Q974S5_SULTO | Q974S5 from UniProtKB/TrEMBL  Length:373

    Alignment length:373
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370   
         Q974S5_SULTO     1 MEIKKGLEDVYVKETEITYIDGELGRLYYRGYSIYDLAEFSNFEEVSYLILYGKLPNREELNWFQEKLREERYLPDFIIKFLREVRKDAQPMDILRTAVSLLGIEDSKNDERTDIKGIKLISKFPTIVANYARLRKGLDIIEPDPKLSHSENFLYMLYGDRPNEIKSKAMDVTLILHIDHEMNASTFASLVVASTFSDLYSSIVAGISALKGPLHGGANYEALKMFKEIGSPEKVNDYILNRLSNKQRIMGFGHRVYKTYDPRARILKQYAKLLAEKEGGEIYTLYQIAEKVEEIGIKYLGPKGIYPNVDFFSSIVFYSLGFEPDFFPAVFASARVVGWVAHIMEYIKDNKIIRPKAYYKGEIGKKYIPIDSR 373
               SCOP domains d1vgpa_ A: automated matches                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------1vgpA01 A:13-216,A:321-353 Citrate Synthase, domain 1                                                                                                                                                       1vgpA02 A:217-320 Cytochrome P450-Terp, domain 2                                                        1vgpA01 A:13-216,A:321-353       -------------------- CATH domains
               Pfam domains -----Citrate_synt-1vgpA01 A:6-355                                                                                                                                                                                                                                                                                                                                  ------------------ Pfam domains
         Sec.struct. author .................eeee....eeee..eehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhhhhhhh....hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhh........hhhhhhhhhh....hhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vgp A   1 MEIKKGLEDVYVKETEITYIDGELGRLYYRGYSIYDLAEFSNFEEVSYLILYGKLPNREELNWFQEKLREERYLPDFIIKFLREVRKDAQPMDILRTAVSLLGIEDSKNDERTDIKGIKLISKFPTIVANYARLRKGLDIIEPDPKLSHSENFLYMLYGDRPNEIKSKAMDVTLILHIDHEMNASTFASLVVASTFSDLYSSIVAGISALKGPLHGGANYEALKMFKEIGSPEKVNDYILNRLSNKQRIMGFGHRVYKTYDPRARILKQYAKLLAEKEGGEIYTLYQIAEKVEEIGIKYLGPKGIYPNVDFFSSIVFYSLGFEPDFFPAVFASARVVGWVAHIMEYIKDNKIIRPKAYYKGEIGKKYIPIDSR 373
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: Citrate_synt] (9)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q974S5_SULTO | Q974S5)
molecular function
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
    GO:0046912    transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor), with the acyl group being converted into alkyl on transfer.
biological process
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1vgp)
 
  Sites
(no "Sites" information available for 1vgp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vgp)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vgp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q974S5_SULTO | Q974S5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.3.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  4.1.3.7
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q974S5_SULTO | Q974S5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1VGP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VGP)