1VF6 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   2.1 ANGSTROM CRYSTAL STRUCTURE OF THE PALS-1-L27N AND PATJ L27 HETERODIMER COMPLEX

Authors :   Y. Li, A. Lavie, B. Margolis, D. Karnak

Date :   09 Apr 04 (Deposition) - 20 Apr 04 (Release) - 07 Dec 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)
Biol. Unit 3: A,B,C,D  (2x)
Biol. Unit 4: A,B,C,D  (1x)

Keywords :   L27 Domain, Heterodimer, Four-Helical Bundle, Coiled-Coil, Hydrophobic Packing Interactions, Protein Binding-Protein Transport Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Li, D. Karnak, B. Demeler, B. Margolis, A. Lavie
Structural Basis For L27 Domain-Mediated Assembly Of Signaling And Cell Polarity Complexes.
Embo J. V. 23 2723 2004
PubMed-ID: 15241471 | Reference-DOI: 10.1038/SJ.EMBOJ.7600294

Molecule 1 - PALS1-ASSOCIATED TIGHT JUNCTION PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PACYCDUET-1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	L27N DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PALS-1

Molecule 2 - MAGUK P55 SUBFAMILY MEMBER 5
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PACYCDUET-1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	L27 DOMAIN
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	PATJ, PROTEIN ASSOCIATED WITH LIN-7 1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D
Biological Unit 3 (2x)	:	A	B	C	D
Biological Unit 4 (1x)	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1VF6)

(no "Site" information available for 1VF6)

(no "SS Bond" information available for 1VF6)

(no "Cis Peptide Bond" information available for 1VF6)

(no "SAP(SNP)/Variant" information available for 1VF6)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L27	PS51022	L27 domain profile.	MPP5_MOUSE	120-177 179-235	1	C:123-170 -

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L27	PS51022	L27 domain profile.	MPP5_MOUSE	120-177 179-235	1	C:123-170 -

Biological Unit 2 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L27	PS51022	L27 domain profile.	MPP5_MOUSE	120-177 179-235	0	- -

Biological Unit 3 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L27	PS51022	L27 domain profile.	MPP5_MOUSE	120-177 179-235	2	C:123-170 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L27	PS51022	L27 domain profile.	MPP5_MOUSE	120-177 179-235	1	C:123-170 -

Asymmetric Unit (2, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000371158	1	ENSE00001341045	chr1:62208149-62208227	79	INADL_HUMAN	-	0	0	-	-
1.2	ENST00000371158	2	ENSE00002140234	chr1:62228530-62228586	57	INADL_HUMAN	1-8	8	0	-	-
1.3	ENST00000371158	3	ENSE00001653283	chr1:62228685-62228851	167	INADL_HUMAN	8-63	56	2	A:12-63 B:10-63	52 54
1.4	ENST00000371158	4	ENSE00001596231	chr1:62231951-62232145	195	INADL_HUMAN	64-128	65	2	A:64-69 B:64-69	6 6
1.5	ENST00000371158	5	ENSE00001747515	chr1:62234955-62235094	140	INADL_HUMAN	129-175	47	0	-	-
1.6	ENST00000371158	6	ENSE00001756534	chr1:62237103-62237298	196	INADL_HUMAN	175-240	66	0	-	-
1.7	ENST00000371158	7	ENSE00001714688	chr1:62240878-62241006	129	INADL_HUMAN	241-283	43	0	-	-
1.8	ENST00000371158	8	ENSE00001680186	chr1:62253426-62253644	219	INADL_HUMAN	284-356	73	0	-	-
1.9	ENST00000371158	9	ENSE00001684863	chr1:62257020-62257119	100	INADL_HUMAN	357-390	34	0	-	-
1.10	ENST00000371158	10	ENSE00001621384	chr1:62261139-62261230	92	INADL_HUMAN	390-420	31	0	-	-
1.11	ENST00000371158	11	ENSE00001704241	chr1:62262959-62263100	142	INADL_HUMAN	421-468	48	0	-	-
1.12	ENST00000371158	12	ENSE00001701190	chr1:62267295-62267441	147	INADL_HUMAN	468-517	50	0	-	-
1.13a	ENST00000371158	13a	ENSE00001634823	chr1:62271120-62271196	77	INADL_HUMAN	517-542	26	0	-	-
1.14	ENST00000371158	14	ENSE00001180884	chr1:62274146-62274202	57	INADL_HUMAN	543-561	19	0	-	-
1.15	ENST00000371158	15	ENSE00001313645	chr1:62288617-62288751	135	INADL_HUMAN	562-606	45	0	-	-
1.16	ENST00000371158	16	ENSE00001011133	chr1:62293094-62293255	162	INADL_HUMAN	607-660	54	0	-	-
1.17	ENST00000371158	17	ENSE00001011140	chr1:62299326-62299457	132	INADL_HUMAN	661-704	44	0	-	-
1.18	ENST00000371158	18	ENSE00001011138	chr1:62321702-62321911	210	INADL_HUMAN	705-774	70	0	-	-
1.19	ENST00000371158	19	ENSE00001011136	chr1:62327223-62327339	117	INADL_HUMAN	775-813	39	0	-	-
1.20a	ENST00000371158	20a	ENSE00001011158	chr1:62329910-62330305	396	INADL_HUMAN	814-945	132	0	-	-
1.22a	ENST00000371158	22a	ENSE00001011157	chr1:62340915-62341038	124	INADL_HUMAN	946-987	42	0	-	-
1.23	ENST00000371158	23	ENSE00001011142	chr1:62349909-62350080	172	INADL_HUMAN	987-1044	58	0	-	-
1.24	ENST00000371158	24	ENSE00001011134	chr1:62365255-62365326	72	INADL_HUMAN	1044-1068	25	0	-	-
1.25	ENST00000371158	25	ENSE00001011132	chr1:62366954-62367131	178	INADL_HUMAN	1068-1127	60	0	-	-
1.26	ENST00000371158	26	ENSE00001011151	chr1:62374044-62374154	111	INADL_HUMAN	1128-1164	37	0	-	-
1.27	ENST00000371158	27	ENSE00001011139	chr1:62380259-62380336	78	INADL_HUMAN	1165-1190	26	0	-	-
1.28b	ENST00000371158	28b	ENSE00001011147	chr1:62393402-62393501	100	INADL_HUMAN	1191-1224	34	0	-	-
1.30a	ENST00000371158	30a	ENSE00001170290	chr1:62455840-62456036	197	INADL_HUMAN	1224-1289	66	0	-	-
1.32	ENST00000371158	32	ENSE00001011145	chr1:62483528-62483619	92	INADL_HUMAN	1290-1320	31	0	-	-
1.33	ENST00000371158	33	ENSE00001011135	chr1:62503649-62503721	73	INADL_HUMAN	1320-1344	25	0	-	-
1.34	ENST00000371158	34	ENSE00001066757	chr1:62516638-62516730	93	INADL_HUMAN	1345-1375	31	0	-	-
1.35a	ENST00000371158	35a	ENSE00001066756	chr1:62545122-62545239	118	INADL_HUMAN	1376-1415	40	0	-	-
1.36	ENST00000371158	36	ENSE00001066761	chr1:62550187-62550320	134	INADL_HUMAN	1415-1459	45	0	-	-
1.38	ENST00000371158	38	ENSE00001066759	chr1:62574109-62574192	84	INADL_HUMAN	1460-1487	28	0	-	-
1.39a	ENST00000371158	39a	ENSE00002161466	chr1:62579725-62579918	194	INADL_HUMAN	1488-1552	65	0	-	-
1.40	ENST00000371158	40	ENSE00001775347	chr1:62582204-62582351	148	INADL_HUMAN	1552-1601	50	0	-	-
1.41a	ENST00000371158	41a	ENSE00001639463	chr1:62582804-62582890	87	INADL_HUMAN	1602-1630	29	0	-	-
1.42b	ENST00000371158	42b	ENSE00001668046	chr1:62586853-62586967	115	INADL_HUMAN	1631-1669	39	0	-	-
1.43	ENST00000371158	43	ENSE00001794870	chr1:62588693-62588730	38	INADL_HUMAN	1669-1681	13	0	-	-
1.44a	ENST00000371158	44a	ENSE00001618976	chr1:62593644-62593766	123	INADL_HUMAN	1682-1722	41	0	-	-
1.45	ENST00000371158	45	ENSE00001716409	chr1:62594513-62594617	105	INADL_HUMAN	1723-1757	35	0	-	-
1.46	ENST00000371158	46	ENSE00001721876	chr1:62613956-62614062	107	INADL_HUMAN	1758-1793	36	0	-	-
1.48b	ENST00000371158	48b	ENSE00001714413	chr1:62626580-62629592	3013	INADL_HUMAN	1793-1801	9	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:58
 aligned with INADL_HUMAN | Q8NI35 from UniProtKB/Swiss-Prot  Length:1801

    Alignment length:58
                                    21        31        41        51        61        
          INADL_HUMAN    12 VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPS  69
               SCOP domains d1vf6a_ A: Associated tight junction protein Pals-1        SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: A:12-63 UniProt: 8-63 [INCOMPLETE]   1.4    Transcript 1
                 1vf6 A  12 VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE  69
                                    21        31        41        51        61

Chain B from PDB  Type:PROTEIN  Length:60
 aligned with INADL_HUMAN | Q8NI35 from UniProtKB/Swiss-Prot  Length:1801

    Alignment length:60
                                    19        29        39        49        59        69
          INADL_HUMAN    10 LQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPS  69
               SCOP domains d1vf6b_ B: Associated tight junction protein Pals-1          SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
           Pfam domains (1) L27_2-1vf6B01 B:10-65                                   ---- Pfam domains (1)
           Pfam domains (2) L27_2-1vf6B02 B:10-65                                   ---- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.3  PDB: B:10-63 UniProt: 8-63 [INCOMPLETE]     1.4    Transcript 1
                 1vf6 B  10 LQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE  69
                                    19        29        39        49        59        69

Chain C from PDB  Type:PROTEIN  Length:51
 aligned with MPP5_MOUSE | Q9JLB2 from UniProtKB/Swiss-Prot  Length:675

    Alignment length:58
                                   122       132       142       152       162        
           MPP5_MOUSE   113 ESPHYAVNILDVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT 170
               SCOP domains d1v       f6c_ C: Maguk p55 subfamily member 5, Patj       SCOP domains
               CATH domains 1vf       6C00 C:120-170 Helix hairpin bin                 CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author .hh-------hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------L27  PDB: C:123-170 UniProt: 120-177                PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 1vf6 C 120 QDP-------DVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT 170
                              |      -|      132       142       152       162        
                            122     123

Chain D from PDB  Type:PROTEIN  Length:48
 aligned with MPP5_MOUSE | Q9JLB2 from UniProtKB/Swiss-Prot  Length:675

    Alignment length:48
                                   132       142       152       162        
           MPP5_MOUSE   123 DVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT 170
               SCOP domains d1vf6d_ D: Maguk p55 subfamily member 5, Patj    SCOP domains
               CATH domains 1vf6D00 D:123-170 Helix hairpin bin              CATH domains
           Pfam domains (1) L27_N-1vf6D01 D:123-170                          Pfam domains (1)
           Pfam domains (2) L27_N-1vf6D02 D:123-170                          Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------ SAPs(SNPs)
                    PROSITE L27  PDB: - UniProt: 120-177                     PROSITE
                 Transcript ------------------------------------------------ Transcript
                 1vf6 D 123 DVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT 170
                                   132       142       152       162

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: L27 domain (10)

Superfamily: L27 domain (10)

Family: L27 domain (10)

Protein domain: Associated tight junction protein Pals-1 (2)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d1vf6a_	A:
1b	d1vf6b_	B:

Protein domain: Maguk p55 subfamily member 5, Patj (2)

Mouse (Mus musculus) [TaxId: 10090] (1)

2a	d1vf6c_	C:
2b	d1vf6d_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Helix Hairpins (718)

Homologous Superfamily: Helix hairpin bin (4)

Human (Homo sapiens) (1)

1a	1vf6C00	C:120-170
1b	1vf6D00	D:123-170

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: L27_2] (1)

Family: L27_2 (1)

Homo sapiens (Human) (1)

1a	L27_2-1vf6B01	B:10-65
1b	L27_2-1vf6B02	B:10-65

Clan: no clan defined [family: L27_N] (2)

Family: L27_N (2)

Mus musculus (Mouse) (1)

2a	L27_N-1vf6D01	D:123-170
2b	L27_N-1vf6D02	D:123-170

Asymmetric Unit(hide GO term definitions)

Chain A,B (INADL_HUMAN | Q8NI35)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0070830	bicellular tight junction assembly	The aggregation, arrangement and bonding together of a set of components to form a tight junction, an occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
cellular component
	GO:0045177	apical part of cell	The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0005923	bicellular tight junction	An occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet; the outer leaflets of the two interacting plasma membranes are seen to be tightly apposed where sealing strands are present. Each sealing strand is composed of a long row of transmembrane adhesion proteins embedded in each of the two interacting plasma membranes.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain C,D (MPP5_MOUSE | Q9JLB2)

molecular function
	GO:0004385	guanylate kinase activity	Catalysis of the reaction: ATP + GMP = ADP + GDP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0046710	GDP metabolic process	The chemical reactions and pathways involving GDP, guanosine 5'-diphosphate.
	GO:0046037	GMP metabolic process	The chemical reactions and pathways involving GMP, guanosine monophosphate.
	GO:0070830	bicellular tight junction assembly	The aggregation, arrangement and bonding together of a set of components to form a tight junction, an occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet.
	GO:0090162	establishment of epithelial cell polarity	The specification and formation of anisotropic intracellular organization of an epithelial cell.
	GO:0090002	establishment of protein localization to plasma membrane	The directed movement of a protein to a specific location in the plasma membrane.
	GO:0002011	morphogenesis of an epithelial sheet	The process in which the anatomical structures of an epithelial sheet are generated and organized. An epithelial sheet is a flat surface consisting of closely packed epithelial cells.
	GO:0032288	myelin assembly	The process in which the wraps of cell membrane that constitute myelin are laid down around an axon in the central or peripheral nervous system.
	GO:0032287	peripheral nervous system myelin maintenance	The process in which the structure and material content of mature peripheral nervous system myelin is kept in a functional state.
	GO:0007009	plasma membrane organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the plasma membrane.
	GO:0035750	protein localization to myelin sheath abaxonal region	Any process in which a protein is transported to, and/or maintained in, the abaxonal region of the myelin sheath. The abaxonal region is the region of the myelin sheath furthest from the axon.
cellular component
	GO:0043220	Schmidt-Lanterman incisure	Regions within compact myelin in which the cytoplasmic faces of the enveloping myelin sheath are not tightly juxtaposed, and include cytoplasm from the cell responsible for making the myelin. Schmidt-Lanterman incisures occur in the compact myelin internode, while lateral loops are analogous structures found in the paranodal region adjacent to the nodes of Ranvier.
	GO:0005923	bicellular tight junction	An occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet; the outer leaflets of the two interacting plasma membranes are seen to be tightly apposed where sealing strands are present. Each sealing strand is composed of a long row of transmembrane adhesion proteins embedded in each of the two interacting plasma membranes.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0012505	endomembrane system	A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0043219	lateral loop	Non-compact myelin located adjacent to the nodes of Ranvier in a myelin segment. These non-compact regions include cytoplasm from the cell responsible for synthesizing the myelin. Lateral loops are found in the paranodal region adjacent to the nodes of Ranvier, while Schmidt-Lantermann clefts are analogous structures found within the compact myelin internode.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0035749	myelin sheath adaxonal region	The region of the myelin sheath nearest to the axon.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1vf6)

	Sites
(no "Sites" information available for 1vf6)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vf6)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1vf6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	INADL_HUMAN \| Q8NI35
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	MPP5_MOUSE \| Q9JLB2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	INADL_HUMAN \| Q8NI35
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	MPP5_MOUSE \| Q9JLB2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	INADL_HUMAN \| Q8NI35	:	2d92 2daz 2db5 2dlu 2dm8 2dmz 2ehr 4q2n
	MPP5_MOUSE \| Q9JLB2	:	1va8

1rso	THE PROTEIN SEQUENCE WE USED IS HAS SIMILARITY TO THE 1RSO SEQUENCE, BUT OUR PROTEINS ARE TOTALLY DIFFERENT PROTEINS

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (2, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (1, 2)

Pfam Domains (2, 4)

Gene Ontology (30, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File