1V9J - JenaLib

Title :   SOLUTION STRUCTURE OF A BOLA-LIKE PROTEIN FROM MUS MUSCULUS

Authors :   T. Kasai, M. Inoue, S. Koshiba, T. Yabuki, M. Aoki, E. Nunokawa, E. Seki, T. Matsuda, N. Matsuda, Y. Tomo, M. Shirouzu, T. Terada, N. Obayashi, H. Hamana, N. Shinya, A. Tatsuguchi, S. Yasuda, M. Yoshida, H. Hirota, Y. Matsuo, K. Tani, H. Suzuki, T. Arakawa, P. Carninci, J. Kawai, Y. Hayashizaki, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   26 Jan 04 (Deposition) - 10 Feb 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Stationary Phase Morphogene, Stress-Induced Morphogene, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Kasai, M. Inoue, S. Koshiba, T. Yabuki, M. Aoki, E. Nunokawa, E. Seki, T. Matsuda, N. Matsuda, Y. Tomo, M. Shirouzu, T. Terada, N. Obayashi, H. Hamana, N. Shinya, A. Tatsuguchi, S. Yasuda, M. Yoshida, H. Hirota, Y. Matsuo, K. Tani, H. Suzuki, T. Arakawa, P. Carninci, J. Kawai, Y. Hayashizaki, T. Kigawa, S. Yokoyama
Solution Structure Of A Bola-Like Protein From Mus Musculus
Protein Sci. V. 13 545 2004
PubMed-ID: 14718656 | Reference-DOI: 10.1110/PS.03401004
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with BOLA2_MOUSE | Q8BGS2 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:113
                                                       1                                                                                     
                                     -         -       | 3        13        23        33        43        53        63        73        83   
          BOLA2_MOUSE     - ---------------------------MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFEQKTLTPEQWTRQRRE  86
               SCOP domains d1v9ja_ A: BolA-like protein                                                                                      SCOP domains
               CATH domains 1v9jA00 A:1-113 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................hhhhhhhhhhhhhh..eeeeee.........eeeeee.hhhhhhhhhhhhhhhhhhh..hhhhh..eeeeeehhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 1v9j A   1 MKGSSHHHHHHSSGASLVPRGSEGAATMELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFEQKTLTPEQWTRQRRE 113
                                    10        20        30        40        50        60        70        80        90       100       110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

NMR Structure(hide GO term definitions)

Chain A (BOLA2_MOUSE | Q8BGS2)

molecular function
	GO:0003674	molecular_function	Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1v9j)

	Sites
(no "Sites" information available for 1v9j)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1v9j)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1v9j
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BOLA2_MOUSE \| Q8BGS2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BOLA2_MOUSE \| Q8BGS2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description