|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1V74) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1V74) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1V74) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1V74) |
Exons (0, 0)| (no "Exon" information available for 1V74) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:107 aligned with CEAD_ECOLX | P17998 from UniProtKB/Swiss-Prot Length:697 Alignment length:107 600 610 620 630 640 650 660 670 680 690 CEAD_ECOLX 591 LNDPLDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL 697 SCOP domains d1v74a_ A: Colicin D nuclease domain SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------Colicin_D-1v74A01 A:604-695 -- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------- Transcript 1v74 A 591 LNDPLDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL 697 600 610 620 630 640 650 660 670 680 690 Chain B from PDB Type:PROTEIN Length:87 aligned with IMMD_ECOLX | P11899 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 IMMD_ECOLX 1 MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL 87 SCOP domains d1v74b_ B: Colicin D immunity protein SCOP domains CATH domains --------------------------------------------------------------------------------------- CATH domains Pfam domains Colicin_immun-1v74B01 B:1-86 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1v74 B 1 MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL 87 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1V74) |
Pfam Domains (2, 2)
Asymmetric/Biological Unit
|
Gene Ontology (9, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (CEAD_ECOLX | P17998)
Chain B (IMMD_ECOLX | P11899)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|