Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE STERILE ALPHA MOTIF (SAM) DOMAIN OF MOUSE SAMSN1
 
Authors :  A. Goroncy, T. Kigawa, S. Koshiba, N. Kobayashi, N. Tochio, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  29 Oct 03  (Deposition) - 29 Apr 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Hypothetical Protein, Riken Structural Genomics/Proteomics Initiative, Rsgi, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Goroncy, T. Kigawa, S. Koshiba, N. Kobayashi, N. Tochio, M. Inoue, S. Yokoyama
Solution Structure Of The Sterile Alpha Motif (Sam) Domain Of Mouse Samsn1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SAM-DOMAIN PROTEIN SAMSN-1
    Chains: A
    Engineered: YES
    Expression System Plasmid: P030120-80
    Expression System Vector Type: PLASMID
    Fragment: STERILE ALPHA MOTIF (SAM) DOMAIN
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Other Details: CELL-FREE PROTEIN SYNTHESIS
    Synonym: SAMSN1, SAM DOMAIN, SH3 DOMAIN AND NUCLEAR LOCALISATION SIGNALS PROTEIN 1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1V38)

(-) Sites  (0, 0)

(no "Site" information available for 1V38)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1V38)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1V38)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1V38)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_DOMAINPS50105 SAM domain profile.SAMN1_MOUSE241-305  1A:10-72

(-) Exons   (0, 0)

(no "Exon" information available for 1V38)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:78
 aligned with SAMN1_MOUSE | P57725 from UniProtKB/Swiss-Prot  Length:372

    Alignment length:207
                                   141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
          SAMN1_MOUSE   132 GQSSSSGITSCSDGTSNRDSFRLDDDSPYSGPFCGRAKVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVILEEEAAPKKIKVPRSRRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLDEETTVEHEKESVPLSSNPDILSASQLEDCPRDSG 338
               SCOP domains d1v38a_                                                                                                     A: Sam-domain protein samsn-1                                                                       SCOP domains
               CATH domains 1v38A00                                                                                                     A:1-78 Transcription Factor, Ets-1                                                                  CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......----------------------------------------------------------------------------------------------------......hhhhhhhhhhhhhhhhhhhhhh..hhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhh----------------h..-------------... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------SAM_DOMAIN  PDB: A:10-72 UniProt: 241-305                        --------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1v38 A   1 GSSGSSG----------------------------------------------------------------------------------------------------RRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLL----------------SGP-------------SSG  78
                                  |  -         -         -         -         -         -         -         -         -         -       |10        20        30        40        50        60        70 |       -        74|        -    |  
                                  7                                                                                                    8                                                              72               73 |            76  
                                                                                                                                                                                                                         75
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1V38)

(-) Gene Ontology  (9, 9)

NMR Structure(hide GO term definitions)
Chain A   (SAMN1_MOUSE | P57725)
molecular function
    GO:0001784    phosphotyrosine residue binding    Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
biological process
    GO:0050869    negative regulation of B cell activation    Any process that stops, prevents, or reduces the frequency, rate or extent of B cell activation.
    GO:0002820    negative regulation of adaptive immune response    Any process that stops, prevents, or reduces the frequency, rate, or extent of an adaptive immune response.
    GO:0050732    negative regulation of peptidyl-tyrosine phosphorylation    Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
cellular component
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0001726    ruffle    Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1v38)
 
  Sites
(no "Sites" information available for 1v38)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1v38)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1v38
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SAMN1_MOUSE | P57725
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SAMN1_MOUSE | P57725
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1V38)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1V38)