Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  AXH DOMAIN OF THE TRANSCRIPTION FACTOR HBP1 FROM M.MUSCULUS
 
Authors :  C. De Chiara, G. Kelly, A. Pastore
Date :  24 Mar 04  (Deposition) - 21 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Dna-Binding Protein, Transcription Factor, Protein-Protein Interaction, Nucleic Acid Binding, Ob-Fold, Ataxin-1 Homologous, Repressor, Transcription, Transcription Regulation, Wnt Signaling Pathway (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. De Chiara, R. P. Menon, S. Adinolfi, J. De Boer, E. Ktistaki, G. Kelly, L. Calder, D. Kioussis, A. Pastore
The Axh Domain Adopts Alternative Folds The Solution Structure Of Hbp1 Axh.
Structure V. 13 743 2005
PubMed-ID: 15893665  |  Reference-DOI: 10.1016/J.STR.2005.02.016
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HMG BOX-CONTAINING PROTEIN 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET24D
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    FragmentAXH DOMAIN, RESIDUES 208-345
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymHBP1, HMG-BOX CONTAINING PROTEIN-1, HMG BOX TRANSCRIPTION FACTOR 1, HIGH MOBILITY GROUP BOX TRANSCRIPTION FACTOR 1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1V06)

(-) Sites  (0, 0)

(no "Site" information available for 1V06)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1V06)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1V06)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1V06)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1V06)

(-) Exons   (0, 0)

(no "Exon" information available for 1V06)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:138
 aligned with HBP1_MOUSE | Q8R316 from UniProtKB/Swiss-Prot  Length:516

    Alignment length:138
                                   217       227       237       247       257       267       277       287       297       307       317       327       337        
           HBP1_MOUSE   208 PSTIWHCFLKGTRLCFHKESNKEWQDVEDFARAASCDNEEEIQMGTHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEIHIGDVCLPPGHPDAINF 345
               SCOP domains d1v06a_ A: automated matches                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -------AXH-1v06A01 A:215-340                                                                                                         ----- Pfam domains
         Sec.struct. author ............eeee........eehhhhhhhh....................eeeeeeeeeee..eeeeeeeee..hhhhh.eeeee.....eee...eeee.hhhhhhhhhh...ee.....ee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1v06 A 208 PSTIWHCFLKGTRLCFHKESNKEWQDVEDFARAASCDNEEEIQMGTHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEIHIGDVCLPPGHPDAINF 345
                                   217       227       237       247       257       267       277       287       297       307       317       327       337        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1V06)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (HBP1_MOUSE | Q8R316)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1v06)
 
  Sites
(no "Sites" information available for 1v06)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1v06)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1v06
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HBP1_MOUSE | Q8R316
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HBP1_MOUSE | Q8R316
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HBP1_MOUSE | Q8R3161s5r

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1V06)