1UW4 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   THE STRUCTURAL BASIS OF THE INTERACTION BETWEEN NONSENSE MEDIATED DECAY FACTORS UPF2 AND UPF3

Authors :   J. Kadlec, E. Izaurralde, S. Cusack

Date :   29 Jan 04 (Deposition) - 11 Mar 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.95

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Nonsense Mediated Mrna Decay Protein, Rna-Binding Protein, Nmd, Rnp Domain, Mif4G Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Kadlec, E. Izaurralde, S. Cusack
The Structural Basis For The Interaction Between Nonsense-Mediated Mrna Decay Factors Upf2 And Upf3
Nat. Struct. Mol. Biol. V. 11 330 2004
PubMed-ID: 15004547 | Reference-DOI: 10.1038/NSMB741

Molecule 1 - REGULATOR OF NONSENSE TRANSCRIPTS 2
	Cell Line	:	HELA-CELL
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PPROEXHTB
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	MIF4G DOMAIN, RESIDUES 768-1015
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	UPF2

Molecule 2 - UPF3X
	Cell Line	:	HELA-CELL
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PPROEXHTB
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	RRM DOMAIN, RESIDUES 50-140
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RNA PROCESSING PROTEIN, UPF3B

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	BME	2	Ligand/Ion	BETA-MERCAPTOETHANOL

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	BME	1	Ligand/Ion	BETA-MERCAPTOETHANOL

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	BME	1	Ligand/Ion	BETA-MERCAPTOETHANOL

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS B:811 , CYS B:812 , ASN B:815	BINDING SITE FOR RESIDUE BME B3016
2	AC2	SOFTWARE	CYS D:811 , CYS D:812 , ASN D:815	BINDING SITE FOR RESIDUE BME D3016

(no "SS Bond" information available for 1UW4)

Asymmetric Unit

No.	Residues
1	Gln A:72	-	Pro A:73
2	Tyr A:90	-	Pro A:91
3	Gln C:72	-	Pro C:73
4	Tyr C:90	-	Pro C:91

(no "SAP(SNP)/Variant" information available for 1UW4)

(no "PROSITE Motif" information available for 1UW4)

Asymmetric Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000276201	1	ENSE00001138295	X:118986961-118986736	226	REN3B_HUMAN	1-52	52	2	A:50-52 C:50-52	3 3
1.2	ENST00000276201	2	ENSE00000854498	X:118985836-118985730	107	REN3B_HUMAN	53-88	36	2	A:53-88 C:53-88	36 36
1.3	ENST00000276201	3	ENSE00000854497	X:118985564-118985458	107	REN3B_HUMAN	88-124	37	2	A:88-124 C:88-124	37 37
1.4a	ENST00000276201	4a	ENSE00000854496	X:118979259-118979161	99	REN3B_HUMAN	124-157	34	2	A:124-140 C:124-140	17 17
1.5	ENST00000276201	5	ENSE00000854495	X:118977264-118977154	111	REN3B_HUMAN	157-194	38	0	-	-
1.6	ENST00000276201	6	ENSE00000854494	X:118975741-118975698	44	REN3B_HUMAN	194-208	15	0	-	-
1.7	ENST00000276201	7	ENSE00000979318	X:118975221-118975039	183	REN3B_HUMAN	209-269	61	0	-	-
1.8a	ENST00000276201	8a	ENSE00000979319	X:118974647-118974609	39	REN3B_HUMAN	270-282	13	0	-	-
1.9a	ENST00000276201	9a	ENSE00000979322	X:118972490-118972330	161	REN3B_HUMAN	283-336	54	0	-	-
1.10	ENST00000276201	10	ENSE00000854492	X:118972014-118971720	295	REN3B_HUMAN	336-434	99	0	-	-
1.11b	ENST00000276201	11b	ENSE00001848175	X:118968990-118967985	1006	REN3B_HUMAN	435-483	49	0	-	-

2.1b	ENST00000397053	1b	ENSE00001402467	chr10:12085023-12084913	111	RENT2_HUMAN	-	0	0	-	-
2.3c	ENST00000397053	3c	ENSE00002187710	chr10:12077440-12077058	383	RENT2_HUMAN	1-122	122	0	-	-
2.4	ENST00000397053	4	ENSE00000999707	chr10:12071523-12070744	780	RENT2_HUMAN	122-382	261	0	-	-
2.5	ENST00000397053	5	ENSE00001349465	chr10:12056183-12056023	161	RENT2_HUMAN	382-436	55	0	-	-
2.6	ENST00000397053	6	ENSE00001213473	chr10:12046726-12046529	198	RENT2_HUMAN	436-502	67	0	-	-
2.7	ENST00000397053	7	ENSE00001213468	chr10:12043824-12043675	150	RENT2_HUMAN	502-552	51	0	-	-
2.8b	ENST00000397053	8b	ENSE00001213463	chr10:12042008-12041905	104	RENT2_HUMAN	552-586	35	0	-	-
2.9	ENST00000397053	9	ENSE00001754391	chr10:12039756-12039671	86	RENT2_HUMAN	587-615	29	0	-	-
2.10	ENST00000397053	10	ENSE00001649308	chr10:12021164-12021056	109	RENT2_HUMAN	615-651	37	0	-	-
2.11	ENST00000397053	11	ENSE00001649100	chr10:12009453-12009340	114	RENT2_HUMAN	652-689	38	0	-	-
2.12	ENST00000397053	12	ENSE00001742008	chr10:12006124-12006008	117	RENT2_HUMAN	690-728	39	0	-	-
2.13	ENST00000397053	13	ENSE00001617394	chr10:12001355-12001170	186	RENT2_HUMAN	729-790	62	2	B:768-790 D:768-790	23 23
2.14	ENST00000397053	14	ENSE00001724518	chr10:11998522-11998319	204	RENT2_HUMAN	791-858	68	2	B:791-858 D:791-858	68 68
2.15	ENST00000397053	15	ENSE00001595330	chr10:11997506-11997231	276	RENT2_HUMAN	859-950	92	2	B:859-950 D:859-950	92 92
2.16	ENST00000397053	16	ENSE00001647744	chr10:11994248-11994065	184	RENT2_HUMAN	951-1012	62	2	B:951-1012 D:951-1012	62 62
2.17	ENST00000397053	17	ENSE00001662463	chr10:11990507-11990368	140	RENT2_HUMAN	1012-1058	47	2	B:1012-1015 D:1012-1015	4 4
2.18	ENST00000397053	18	ENSE00001754512	chr10:11985167-11985063	105	RENT2_HUMAN	1059-1093	35	0	-	-
2.19	ENST00000397053	19	ENSE00001760455	chr10:11984762-11984664	99	RENT2_HUMAN	1094-1126	33	0	-	-
2.20	ENST00000397053	20	ENSE00001094605	chr10:11978711-11978544	168	RENT2_HUMAN	1127-1182	56	0	-	-
2.21b	ENST00000397053	21b	ENSE00001094602	chr10:11973781-11973640	142	RENT2_HUMAN	1183-1230	48	0	-	-
2.22	ENST00000397053	22	ENSE00001094595	chr10:11971984-11971864	121	RENT2_HUMAN	1230-1270	41	0	-	-
2.23a	ENST00000397053	23a	ENSE00001213550	chr10:11963306-11962022	1285	RENT2_HUMAN	1270-1272	3	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:91
 aligned with REN3B_HUMAN | Q9BZI7 from UniProtKB/Swiss-Prot  Length:483

    Alignment length:91
                                    59        69        79        89        99       109       119       129       139 
         REN3B_HUMAN     50 LSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAA  140
               SCOP domains d1uw4a_ A: RNA processing protein UPF3x, RRM domain                                         SCOP domains
               CATH domains 1uw4A00 A:50-140  [code=3.30.70.330, no name defined]                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....hhhhhhhhhh....eeeeeeee..........eeeeeee..hhhhhhhhhhhh..eee.....eee.eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1Exon 1.2  PDB: A:53-88              -----------------------------------Exon 1.4a         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3  PDB: A:88-124              ---------------- Transcript 1 (2)
                1uw4 A   50 LSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAA  140
                                    59        69        79        89        99       109       119       129       139

Chain B from PDB  Type:PROTEIN  Length:248
 aligned with RENT2_HUMAN | Q9HAU5 from UniProtKB/Swiss-Prot  Length:1272

    Alignment length:248
                                   777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007        
         RENT2_HUMAN    768 RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN 1015
               SCOP domains d1uw4b_ B: Regulator of nonsense transcripts 2, UPF2                                                                                                                                                                                                     SCOP domains
               CATH domains 1uw4B00 B:768-1015  [code=1.25.40.180, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh.....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.13 [INCOMPLETE] Exon 2.14  PDB: B:791-858 UniProt: 791-858                          Exon 2.15  PDB: B:859-950 UniProt: 859-950                                                  Exon 2.16  PDB: B:951-1012 UniProt: 951-1012                  --- Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2.17 Transcript 2 (2)
                1uw4 B  768 RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN 1015
                                   777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007

Chain C from PDB  Type:PROTEIN  Length:91
 aligned with REN3B_HUMAN | Q9BZI7 from UniProtKB/Swiss-Prot  Length:483

    Alignment length:91
                                    59        69        79        89        99       109       119       129       139 
         REN3B_HUMAN     50 LSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAA  140
               SCOP domains d1uw4c_ C: RNA processing protein UPF3x, RRM domain                                         SCOP domains
               CATH domains 1uw4C00 C:50-140  [code=3.30.70.330, no name defined]                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....hhhhhhhhhh....eeeeeee...........eeeeeee.hhhhhhhhhhhhh..eee.....eee.eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1Exon 1.2  PDB: C:53-88              -----------------------------------Exon 1.4a         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3  PDB: C:88-124              ---------------- Transcript 1 (2)
                1uw4 C   50 LSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAA  140
                                    59        69        79        89        99       109       119       129       139

Chain D from PDB  Type:PROTEIN  Length:248
 aligned with RENT2_HUMAN | Q9HAU5 from UniProtKB/Swiss-Prot  Length:1272

    Alignment length:248
                                   777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007        
         RENT2_HUMAN    768 RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN 1015
               SCOP domains d1uw4d_ D: Regulator of nonsense transcripts 2, UPF2                                                                                                                                                                                                     SCOP domains
               CATH domains 1uw4D00 D:768-1015  [code=1.25.40.180, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.13 [INCOMPLETE] Exon 2.14  PDB: D:791-858 UniProt: 791-858                          Exon 2.15  PDB: D:859-950 UniProt: 859-950                                                  Exon 2.16  PDB: D:951-1012 UniProt: 951-1012                  --- Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2.17 Transcript 2 (2)
                1uw4 D  768 RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVN 1015
                                   777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.330, no name defined] (307)

Human (Homo sapiens) (81)

1a	1uw4A00	A:50-140
1b	1uw4C00	C:50-140

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.180, no name defined] (12)

Human (Homo sapiens) (10)

2a	1uw4B00	B:768-1015
2b	1uw4D00	D:768-1015

(no "Pfam Domain" information available for 1UW4)

Asymmetric Unit(hide GO term definitions)

Chain A,C (REN3B_HUMAN | Q9BZI7)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0005487	nucleocytoplasmic transporter activity	Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0031124	mRNA 3'-end processing	Any process involved in forming the mature 3' end of an mRNA molecule.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0045727	positive regulation of translation	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0035145	exon-exon junction complex	A multi-subunit complex deposited by the spliceosome upstream of messenger RNA exon-exon junctions. The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D (RENT2_HUMAN | Q9HAU5)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042162	telomeric DNA binding	Interacting selectively and non-covalently with a telomere, a specific structure at the end of a linear chromosome required for the integrity and maintenance of the end.
biological process
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0001889	liver development	The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0035145	exon-exon junction complex	A multi-subunit complex deposited by the spliceosome upstream of messenger RNA exon-exon junctions. The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BME	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln A:72 - Pro A:73	[ RasMol ]
		Gln C:72 - Pro C:73	[ RasMol ]
		Tyr A:90 - Pro A:91	[ RasMol ]
		Tyr C:90 - Pro C:91	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1uw4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	REN3B_HUMAN \| Q9BZI7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RENT2_HUMAN \| Q9HAU5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	REN3B_HUMAN \| Q9BZI7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RENT2_HUMAN \| Q9HAU5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	REN3B_HUMAN \| Q9BZI7	:	2xb2
	RENT2_HUMAN \| Q9HAU5	:	2wjv 4cek 4cem

(no "Related Entries Specified in the PDB File" available for 1UW4)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (25, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File