1UV7 - JenaLib

Title :   PERIPLASMIC DOMAIN OF EPSM FROM VIBRIO CHOLERAE

Authors :   J. Abendroth, W. G. J. Hol

Date :   15 Jan 04 (Deposition) - 23 Apr 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : A,B

Keywords :   General Secretion Pathway, Vibrio Cholerae, Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Abendroth, A. Rice, K. Mcluskey, M. Bagdasarian, W. G. J. Hol
The Crystal Structure Of The Periplasmic Domain Of The Type Ii Secretion System Protein Epsm From Vibrio Cholerae: The Simplest Version Of The Ferredoxin Fold
J. Mol. Biol. V. 338 585 2004
PubMed-ID: 15081815 | Reference-DOI: 10.1016/J.JMB.2004.01.064

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:76
 aligned with GSPM_VIBCH | P41851 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:80
                                    95       105       115       125       135       145       155       165
           GSPM_VIBCH    86 QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGKVNGVVEVKRLQLKRGG 165
               SCOP domains d1uv7a_ A: General secretion pathway protein M, EpsM                             SCOP domains
               CATH domains 1uv7A00 A:86-165 General secretion pathway protein M, EpsM                       CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..eeeeee...eeeeee...hhhhhhhhhhhhhhhh..eeeeeeeee.----.eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                 1uv7 A  86 QPLNQVITNSTRQFNIELIRVQPRGEmmQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRG----VVEVKRLQLKRGG 165
                                    95       105      |115       125       135       145  |    155       165
                                                    112-MSE                             148  153            
                                                     113-MSE

Chain B from PDB  Type:PROTEIN  Length:74
 aligned with GSPM_VIBCH | P41851 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:78
                                    95       105       115       125       135       145       155        
           GSPM_VIBCH    86 QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGKVNGVVEVKRLQLKR 163
               SCOP domains d1uv7b_ B: General secretion pathway protein M, EpsM                           SCOP domains
               CATH domains 1uv7B00 B:86-163 General secretion pathway protein M, EpsM                     CATH domains
           Pfam domains (1) T2SM-1uv7B01 B:86-163                                                          Pfam domains (1)
           Pfam domains (2) T2SM-1uv7B02 B:86-163                                                          Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhh...eeeeeee..eeeeee...hhhhhhhhhhhhhhhh..eeeeeeeee.----.eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------ Transcript
                 1uv7 B  86 QPLNQVITNSTRQFNIELIRVQPRGEmmQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRG----VVEVKRLQLKR 163
                                    95       105      |115       125       135       145  |    155        
                                                    112-MSE                             148  153          
                                                     113-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (GSPM_VIBCH | P41851)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006858	extracellular transport	The transport of substances that occurs outside cells.
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1uv7)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1uv7)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1uv7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GSPM_VIBCH \| P41851
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description