Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF OSMOTICALLY INDUCIBLE PROTEIN C FROM THERMUS THERMOPHILUS
 
Authors :  P. H. Rehse, S. Kuramitsu, S. Yokoyama, M. Miyano, T. H. Tahirov, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  24 Aug 03  (Deposition) - 04 May 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Peroxidase, Cysteinesulfinic Acid, Osmotic, Inducible, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. H. Rehse, N. Oshima, Y. Nodaka, T. H. Tahirov
Crystallographic Structure And Biochemical Analysis Of The Thermus Thermophilus Osmotically Inducible Protein C
J. Mol. Biol. V. 338 959 2004
PubMed-ID: 15111059  |  Reference-DOI: 10.1016/J.JMB.2004.03.050

(-) Compounds

Molecule 1 - OSMOTICALLY INDUCIBLE PROTEIN C
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-11A
    Expression System Strain: B834
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 300852
    Strain: HB8

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric/Biological Unit (3, 7)
No.NameCountTypeFull Name
1CSD2Mod. Amino Acid3-SULFINOALANINE
2MSE4Mod. Amino AcidSELENOMETHIONINE
3TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:4 , SER A:25 , GLU A:110 , GLU A:114 , SER B:36 , GLU B:40 , GLY B:41 , GLY B:43 , GLU B:48BINDING SITE FOR RESIDUE TRS B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UKK)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Val A:87 -Asp A:88
2Val B:87 -Asp B:88

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UKK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UKK)

(-) Exons   (0, 0)

(no "Exon" information available for 1UKK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:141
 aligned with P84124_THETH | P84124 from UniProtKB/TrEMBL  Length:142

    Alignment length:141
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141 
         P84124_THETH     2 PVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV 142
               SCOP domains d1ukka_ A: Hypothetical protein MPN625                                                                                                        SCOP domains
               CATH domains 1ukkA00 A:2-142  [code=3.30.300.20, no name defined]                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee......eeeeeehhhheeeeeehhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeeeeee......eeeeeeeeeeee....hhhhhhhhhhhhh..hhhhhhh....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ukk A   2 PVRKAKAVWEGGLRQGKGVmELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGcFSmALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV 142
                                    11        21        31        41        51     |  61        71        81        91       101       111       121       131       141 
                                              21-MSE                              57-CSD                                                                                 
                                                                                     60-MSE                                                                              


Chain B from PDB  Type:PROTEIN  Length:141
 aligned with P84124_THETH | P84124 from UniProtKB/TrEMBL  Length:142

    Alignment length:141
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141 
         P84124_THETH     2 PVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV 142
               SCOP domains d1ukkb_ B: Hypothetical protein MPN625                                                                                                        SCOP domains
               CATH domains 1ukkB00 B:2-142  [code=3.30.300.20, no name defined]                                                                                          CATH domains
           Pfam domains (1) -------------------------------------OsmC-1ukkB01 B:39-138                                                                               ---- Pfam domains (1)
           Pfam domains (2) -------------------------------------OsmC-1ukkB02 B:39-138                                                                               ---- Pfam domains (2)
         Sec.struct. author .eeeeeeeee......eeeeee.....eeeeehhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeeeeeee....eeeeeeeeeeeee....hhhhhhhhhhhhh..hhhhhhh....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ukk B   2 PVRKAKAVWEGGLRQGKGVmELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGcFSmALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV 142
                                    11        21        31        41        51     |  61        71        81        91       101       111       121       131       141 
                                              21-MSE                              57-CSD                                                                                 
                                                                                     60-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: OsmC] (11)
(-)
Family: OsmC (11)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (P84124_THETH | P84124)
molecular function
    GO:0004601    peroxidase activity    Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0006979    response to oxidative stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:87 - Asp A:88   [ RasMol ]  
    Val B:87 - Asp B:88   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ukk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P84124_THETH | P84124
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P84124_THETH | P84124
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1UKK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UKK)