1UJ2 - JenaLib

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:34 , C5P A:2301 , ADP A:2302 , HOH A:2318 , HOH A:2467 , HOH A:2519	BINDING SITE FOR RESIDUE MG A 2303
2	AC2	SOFTWARE	SER B:34 , C5P B:1301 , ADP B:1302 , HOH B:1388 , HOH B:1469 , HOH B:1502	BINDING SITE FOR RESIDUE MG B 1303
3	AC3	SOFTWARE	THR A:29 , ALA A:30 , LYS A:33 , ASP A:62 , TYR A:65 , PHE A:83 , ASP A:84 , TYR A:112 , PHE A:114 , HIS A:117 , ILE A:137 , ARG A:166 , ARG A:169 , ARG A:174 , ARG A:176 , GLN A:184 , ADP A:2302 , MG A:2303 , HOH A:2310 , HOH A:2318 , HOH A:2331	BINDING SITE FOR RESIDUE C5P A 2301
4	AC4	SOFTWARE	GLY A:28 , ALA A:30 , SER A:31 , GLY A:32 , LYS A:33 , SER A:34 , SER A:35 , ARG A:165 , ARG A:169 , ASP A:213 , C5P A:2301 , MG A:2303 , HOH A:2318 , HOH A:2327 , HOH A:2452 , HOH A:2467 , HOH A:2525	BINDING SITE FOR RESIDUE ADP A 2302
5	AC5	SOFTWARE	THR B:29 , ALA B:30 , LYS B:33 , ASP B:62 , TYR B:65 , PHE B:83 , ASP B:84 , TYR B:112 , HIS B:117 , ILE B:137 , ARG B:166 , ARG B:169 , ARG B:174 , ARG B:176 , GLN B:184 , VAL B:189 , ADP B:1302 , MG B:1303 , HOH B:1308 , HOH B:1314 , HOH B:1388	BINDING SITE FOR RESIDUE C5P B 1301
6	AC6	SOFTWARE	ALA B:30 , SER B:31 , GLY B:32 , LYS B:33 , SER B:34 , SER B:35 , ARG B:165 , ARG B:169 , ASP B:213 , C5P B:1301 , MG B:1303 , HOH B:1317 , HOH B:1402 , HOH B:1427 , HOH B:1464 , HOH B:1486 , HOH B:1502	BINDING SITE FOR RESIDUE ADP B 1302

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:213
 aligned with UCK2_HUMAN | Q9BZX2 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:213
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228   
           UCK2_HUMAN    19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNG 231
               SCOP domains d1uj2a_ A: Uridine-cytidine kinase 2                                                                                                                                                                                  SCOP domains
               CATH domains 1uj2A00 A:19-231 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhh...hhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...eeeeeee....eeeeeeeee....eeeee......hhhhhhhh.eeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a      Exon 1.2  PDB: A:34-87 UniProt: 34-87                 -------------------------------Exon 1.6c  PDB: A:119-167 UniProt: 119-167       --------------------------------Exon 1.10        --------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.3  PDB: A:87-119          -----------------------------------------------Exon 1.8b  PDB: A:167-199        ----------------Exon 1.11g       Transcript 1 (2)
                 1uj2 A  19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNG 231
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228

Chain B from PDB  Type:PROTEIN  Length:213
 aligned with UCK2_HUMAN | Q9BZX2 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:213
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228   
           UCK2_HUMAN    19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNG 231
               SCOP domains d1uj2b_ B: Uridine-cytidine kinase 2                                                                                                                                                                                  SCOP domains
               CATH domains 1uj2B00 B:19-231 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                 CATH domains
           Pfam domains (1) ---PRK-1uj2B01 B:22-217                                                                                                                                                                                -------------- Pfam domains (1)
           Pfam domains (2) ---PRK-1uj2B02 B:22-217                                                                                                                                                                                -------------- Pfam domains (2)
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhh...hhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...eeeeeee....eeeeeeeee....eeeee......hhhhhh...eeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeee....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a      Exon 1.2  PDB: B:34-87 UniProt: 34-87                 -------------------------------Exon 1.6c  PDB: B:119-167 UniProt: 119-167       --------------------------------Exon 1.10        --------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.3  PDB: B:87-119          -----------------------------------------------Exon 1.8b  PDB: B:167-199        ----------------Exon 1.11g       Transcript 1 (2)
                 1uj2 B  19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNG 231
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (15, 15)

Asymmetric Unit(hide GO term definitions)

Chain A,B (UCK2_HUMAN | Q9BZX2)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0019206	nucleoside kinase activity	Catalysis of the reaction: ATP + nucleoside = ADP + nucleoside monophosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004849	uridine kinase activity	Catalysis of the reaction: ATP + uridine = ADP + UMP.
biological process
	GO:0006238	CMP salvage	Any process that generates CMP, cytidine monophosphate, from derivatives of it without de novo synthesis.
	GO:0044211	CTP salvage	Any process which produces cytidine 5'-triphosphate (CTP) from derivatives of it, without de novo synthesis.
	GO:0044206	UMP salvage	Any process which produces UMP, uridine monophosphate, from derivatives of it (e.g. cytidine, uridine, cytosine) without de novo synthesis.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006206	pyrimidine nucleobase metabolic process	The chemical reactions and pathways involving pyrimidine nucleobases, 1,3-diazine, organic nitrogenous bases.
	GO:0043097	pyrimidine nucleoside salvage	Any process that generates a pyrimidine nucleoside, one of a family of organic molecules consisting of a pyrimidine base covalently bonded to a sugar ribose, from derivatives of it, without de novo synthesis.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ADP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		C5P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1uj2)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1uj2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UCK2_HUMAN \| Q9BZX2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.1.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (6, 6)