1UFX - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE THIRD PDZ DOMAIN OF HUMAN KIAA1526 PROTEIN

Authors :   N. Tochio, N. Kobayashi, S. Koshiba, T. Kigawa, M. Inoue, M. Shirouzu, T. Terada, T. Yabuki, M. Aoki, E. Seki, T. Matsuda, H. Hirota, M. Yoshida, A. Tanaka, T. Osanai, Y. Matsuo, O. Ohara, T. Nagase, R. Kikuno, M. Nakayama, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   10 Jun 03 (Deposition) - 10 Dec 03 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Pdz Domain, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. Tochio, N. Kobayashi, S. Koshiba, T. Kigawa, M. Inoue, M. Shirouzu, T. Terada, T. Yabuki, M. Aoki, E. Seki, T. Matsuda, H. Hirota, M. Yoshida, A. Tanaka, T. Osanai, Y. Matsuo, O. Ohara, T. Nagase, R. Kikuno, M. Nakayama, S. Yokoyama
Solution Structure Of The Third Pdz Domain Of Human Kiaa1526 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - KIAA1526 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P021030-48
	Expression System Vector Type	:	PLASMID
	Fragment	:	PDZ DOMAIN
	Gene	:	KAZUSA CDNA FJ04743
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UFX)

Sites (0, 0)

(no "Site" information available for 1UFX)

SS Bonds (0, 0)

(no "SS Bond" information available for 1UFX)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1UFX)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_020596	T	813	M	WHRN_HUMAN	Polymorphism	942519	A	S	6	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDZ	PS50106	PDZ domain profile.	WHRN_HUMAN	140-215 279-349 816-887	1	- - A:9-80

Exons (3, 3)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000362057	1c	ENSE00001904019	chr9:117267250-117266464	787	WHRN_HUMAN	1-206	206	0	-	-
1.4a	ENST00000362057	4a	ENSE00001708360	chr9:117241051-117240833	219	WHRN_HUMAN	207-279	73	0	-	-
1.5	ENST00000362057	5	ENSE00001717694	chr9:117228672-117228547	126	WHRN_HUMAN	280-321	42	0	-	-
1.6	ENST00000362057	6	ENSE00001651101	chr9:117188693-117188491	203	WHRN_HUMAN	322-389	68	0	-	-
1.7b	ENST00000362057	7b	ENSE00001141441	chr9:117187304-117187268	37	WHRN_HUMAN	389-401	13	0	-	-
1.8	ENST00000362057	8	ENSE00000722107	chr9:117186826-117186614	213	WHRN_HUMAN	402-472	71	0	-	-
1.9	ENST00000362057	9	ENSE00000505590	chr9:117185803-117185594	210	WHRN_HUMAN	473-542	70	0	-	-
1.10	ENST00000362057	10	ENSE00000722103	chr9:117170298-117170227	72	WHRN_HUMAN	543-566	24	0	-	-
1.11	ENST00000362057	11	ENSE00000722097	chr9:117169172-117168635	538	WHRN_HUMAN	567-746	180	0	-	-
1.12	ENST00000362057	12	ENSE00000722092	chr9:117166357-117166176	182	WHRN_HUMAN	746-806	61	1	A:1-5 (gaps)	25
1.13	ENST00000362057	13	ENSE00000722088	chr9:117165619-117165497	123	WHRN_HUMAN	807-847	41	1	A:6-40	35
1.14a	ENST00000362057	14a	ENSE00001384002	chr9:117165216-117164361	856	WHRN_HUMAN	848-907	60	1	A:41-100	60

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:103
 aligned with WHRN_HUMAN | Q9P202 from UniProtKB/Swiss-Prot  Length:907

    Alignment length:132
                                                                                                                                                          907   
                                   788       798       808       818       828       838       848       858       868       878       888       898        |-  
           WHRN_HUMAN   779 GRQSVSTKSRSSKELPRNERPTDGANKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML---   -
               SCOP domains d         1u           fx         a_ A: KIAA1526 protein                                                                             SCOP domains
               CATH domains 1         uf           xA         00 A:1-103  [code=2.30.42.10, no name defined]                                                     CATH domains
               Pfam domains -------------------------------------PDZ-1ufxA01 A:9-83                                                         -------------------- Pfam domains
         Sec.struct. author .---------..-----------..---------..eeeeee.......eeee..........eeeee...hhhhhhh.........ee..ee....hhhhhhhhhhhhhhh....eeeeee.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------M------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------PDZ  PDB: A:9-80 UniProt: 816-887                                       ----------------------- PROSITE
               Transcript 1 Exon 1.12  PDB: A:1-5 (gaps)Exon 1.13  PDB: A:6-40 UniProt: 807-847  Exon 1.14a  PDB: A:41-100 UniProt: 848-907                  --- Transcript 1
                 1ufx A   1 G---------SS-----------GS---------SGTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNSGPSSG 103
                            |        -||       -   ||    -    |   11        21        31        41        51        61        71        81        91       101  
                            |         2|           4|         6                                                                                                 
                            1          3            5

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: PDZ domain-like (299)

Superfamily: PDZ domain-like (299)

Family: PDZ domain (180)

Protein domain: KIAA1526 protein (3)

Human (Homo sapiens) [TaxId: 9606] (3)

d1ufxa_

CATH Domains (1, 1)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: Pdz3 Domain (191)

Homologous Superfamily: [code=2.30.42.10, no name defined] (191)

Human (Homo sapiens) (120)

1ufxA00

A:1-103

Pfam Domains (1, 1)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PDZ-like (184)

Family: PDZ (172)

Homo sapiens (Human) (96)

PDZ-1ufxA01

A:9-83

Gene Ontology (9, 9)

NMR Structure(hide GO term definitions)

Chain A (WHRN_HUMAN | Q9P202)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0060122	inner ear receptor stereocilium organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a stereocilium. A stereocilium is an actin-based protrusion from the apical surface of inner ear receptor cells.
	GO:0001895	retina homeostasis	A tissue homeostatic process involved in the maintenance of an internal equilibrium within the retina of the eye, including control of cellular proliferation and death and control of metabolic function.
	GO:0050953	sensory perception of light stimulus	The series of events required for an organism to receive a sensory light stimulus, convert it to a molecular signal, and recognize and characterize the signal. This is a neurological process.
	GO:0007605	sensory perception of sound	The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030426	growth cone	The migrating motile tip of a growing nerve cell axon or dendrite.
	GO:0032420	stereocilium	An actin-based protrusion from the apical surface of auditory and vestibular hair cells and of neuromast cells. These protrusions are supported by a bundle of cross-linked actin filaments (an actin cable), oriented such that the plus (barbed) ends are at the tip of the protrusion, capped by a tip complex which bridges to the plasma. Bundles of stereocilia act as mechanosensory organelles.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ufx)

	Sites
(no "Sites" information available for 1ufx)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ufx)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ufx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	WHRN_HUMAN \| Q9P202
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	WHRN_HUMAN \| Q9P202
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	WHRN_HUMAN \| Q9P202	:	1uez 1uf1

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UFX)