|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1UFI) |
(no "Site" information available for 1UFI) |
(no "SS Bond" information available for 1UFI) |
(no "Cis Peptide Bond" information available for 1UFI) |
(no "SAP(SNP)/Variant" information available for 1UFI) |
(no "PROSITE Motif" information available for 1UFI) |
Asymmetric Unit (1, 4)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:48 aligned with CENPB_HUMAN | P07199 from UniProtKB/Swiss-Prot Length:599 Alignment length:48 547 557 567 577 CENPB_HUMAN 538 EVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN 585 SCOP domains d1ufia_ A: Dimerisation domain of CENP-B SCOP domains CATH domains ------------------------------------------------ CATH domains Pfam domains ------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript 1 Exon 1.1 PDB: A:3-50 UniProt: 1-668 Transcript 1 1ufi A 3 HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN 50 12 22 32 42 Chain B from PDB Type:PROTEIN Length:46 aligned with CENPB_HUMAN | P07199 from UniProtKB/Swiss-Prot Length:599 Alignment length:46 549 559 569 579 CENPB_HUMAN 540 PVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN 585 SCOP domains d1ufib_ B: Dimerisation domain of CENP-B SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains ---------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript 1 Exon 1.1 PDB: B:5-50 UniProt: 1-668 Transcript 1 1ufi B 5 PVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKN 50 14 24 34 44 Chain C from PDB Type:PROTEIN Length:48 aligned with CENPB_HUMAN | P07199 from UniProtKB/Swiss-Prot Length:599 Alignment length:48 546 556 566 576 CENPB_HUMAN 537 DEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRK 584 SCOP domains d1ufic_ C: Dimerisation domain of CENP-B SCOP domains CATH domains ------------------------------------------------ CATH domains Pfam domains ------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript 1 Exon 1.1 PDB: C:2-49 UniProt: 1-668 Transcript 1 1ufi C 2 SHMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRK 49 11 21 31 41 Chain D from PDB Type:PROTEIN Length:46 aligned with CENPB_HUMAN | P07199 from UniProtKB/Swiss-Prot Length:599 Alignment length:46 547 557 567 577 CENPB_HUMAN 538 EVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTR 583 SCOP domains d1ufid_ D: Dimerisation domain of CENP-B SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains (1) --Cenp-B_dimeris-1ufiD01 D:5-48 Pfam domains (1) Pfam domains (2) --Cenp-B_dimeris-1ufiD02 D:5-48 Pfam domains (2) Pfam domains (3) --Cenp-B_dimeris-1ufiD03 D:5-48 Pfam domains (3) Pfam domains (4) --Cenp-B_dimeris-1ufiD04 D:5-48 Pfam domains (4) SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript 1 Exon 1.1 PDB: D:3-48 UniProt: 1-668 Transcript 1 1ufi D 3 HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTR 48 12 22 32 42
|
Asymmetric Unit |
(no "CATH Domain" information available for 1UFI) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (CENPB_HUMAN | P07199)
|
|
|
|
|
|
|