Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TT1696 FROM THERMUS THERMOPHILUS HB8
 
Authors :  M. Idaka, K. Murayama, H. Yamaguchi, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  28 May 03  (Deposition) - 28 Nov 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  C,D  (2x)
Biol. Unit 4:  A,B  (2x)
Keywords :  Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Idaka, K. Murayama, H. Yamaguchi, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama
Crystal Structure Of Tt1696 From Thermus Thermophilus Hb8
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TT1696 PROTEIN
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET11A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 274

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD
Biological Unit 3 (2x):   CD
Biological Unit 4 (2x): AB  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UFB)

(-) Sites  (0, 0)

(no "Site" information available for 1UFB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UFB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UFB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UFB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UFB)

(-) Exons   (0, 0)

(no "Exon" information available for 1UFB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:127
 aligned with P83963_THETH | P83963 from UniProtKB/TrEMBL  Length:127

    Alignment length:127
                                    10        20        30        40        50        60        70        80        90       100       110       120       
         P83963_THETH     1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
               SCOP domains d1ufba_ A: Hypothetical protein TT1696                                                                                          SCOP domains
               CATH domains 1ufbA00 A:1-127 Nucleotidyltransferases  domain 2                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.......hhhhhhhhhhhhh......hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ufb A   1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
                                    10        20        30        40        50        60        70        80        90       100       110       120       


Chain B from PDB  Type:PROTEIN  Length:127
 aligned with P83963_THETH | P83963 from UniProtKB/TrEMBL  Length:127

    Alignment length:127
                                    10        20        30        40        50        60        70        80        90       100       110       120       
         P83963_THETH     1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
               SCOP domains d1ufbb_ B: Hypothetical protein TT1696                                                                                          SCOP domains
               CATH domains 1ufbB00 B:1-127 Nucleotidyltransferases  domain 2                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.......hhhhhhhhhhhhh......hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ufb B   1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
                                    10        20        30        40        50        60        70        80        90       100       110       120       


Chain C from PDB  Type:PROTEIN  Length:127
 aligned with P83963_THETH | P83963 from UniProtKB/TrEMBL  Length:127

    Alignment length:127
                                    10        20        30        40        50        60        70        80        90       100       110       120       
         P83963_THETH     1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
               SCOP domains d1ufbc_ C: Hypothetical protein TT1696                                                                                          SCOP domains
               CATH domains 1ufbC00 C:1-127 Nucleotidyltransferases  domain 2                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.......hhhhhhhhhhhhh......hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ufb C   1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
                                    10        20        30        40        50        60        70        80        90       100       110       120       


Chain D from PDB  Type:PROTEIN  Length:127
 aligned with P83963_THETH | P83963 from UniProtKB/TrEMBL  Length:127

    Alignment length:127
                                    10        20        30        40        50        60        70        80        90       100       110       120       
         P83963_THETH     1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
               SCOP domains d1ufbd_ D: Hypothetical protein TT1696                                                                                          SCOP domains
               CATH domains 1ufbD00 D:1-127 Nucleotidyltransferases  domain 2                                                                               CATH domains
           Pfam domains (1) ---HEPN-1ufbD01 D:4-126                                                                                                       - Pfam domains (1)
           Pfam domains (2) ---HEPN-1ufbD02 D:4-126                                                                                                       - Pfam domains (2)
           Pfam domains (3) ---HEPN-1ufbD03 D:4-126                                                                                                       - Pfam domains (3)
           Pfam domains (4) ---HEPN-1ufbD04 D:4-126                                                                                                       - Pfam domains (4)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.......hhhhhhhhhhhhh......hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ufb D   1 MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL 127
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: KNTase_C (11)
(-)
Family: HEPN (3)
(-)
Thermus thermophilus (1)
1aHEPN-1ufbD01D:4-126
1bHEPN-1ufbD02D:4-126
1cHEPN-1ufbD03D:4-126
1dHEPN-1ufbD04D:4-126

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (P83963_THETH | P83963)
molecular function
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ufb)
 
  Sites
(no "Sites" information available for 1ufb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ufb)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ufb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P83963_THETH | P83963
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P83963_THETH | P83963
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1UFB)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UFB)