Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE MATRIX ATTACHMENT REGION-BINDING DOMAIN OF CHICKEN MECP2
 
Authors :  B. Heitmann, T. Maurer, J. M. Weitzel, W. H. Stratling, H. R. Kalbitzer, E. Brunner, Structural Proteomics In Europe (Spine)
Date :  27 Mar 03  (Deposition) - 05 Aug 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Chicken Methyl-Cpg-Binding Protein 2 (Cmecp2), Mar-Binding Protein (Arbp), Nmr Spectroscopy, Protein-Dna Interaction, Structural Proteomics In Europe, Spine, Structural Genomics, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Heitmann, T. Maurer, J. M. Weitzel, W. H. Stratling, H. R. Kalbitzer, E. Brunner
Solution Structure Of The Matrix Attachment Region-Binding Domain Of Chicken Mecp2
Eur. J. Biochem. V. 270 3263 2003
PubMed-ID: 12869202  |  Reference-DOI: 10.1046/J.1432-1033.2003.03714.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ATTACHMENT REGION BINDING PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-CARBP-EX4.2
    Expression System StrainBL21 (DE3) PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentMATRIX ATTACHMENT REGION-BINDING DOMAIN
    Organism CommonCHICKEN
    Organism ScientificGALLUS GALLUS
    Organism Taxid9031
    SynonymMECP2

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UB1)

(-) Sites  (0, 0)

(no "Site" information available for 1UB1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UB1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UB1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UB1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UB1)

(-) Exons   (0, 0)

(no "Exon" information available for 1UB1)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:125
 aligned with O42403_CHICK | O42403 from UniProtKB/TrEMBL  Length:344

    Alignment length:125
                                    81        91       101       111       121       131       141       151       161       171       181       191     
         O42403_CHICK    72 APAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQRPPKKAKSPKSPGSGRGRGRPKGSG 196
               SCOP domains d1ub1a_ A: Methyl-CpG-binding protein 2, MECP2                                                                                SCOP domains
               CATH domains 1ub1A00 A:72-196 Methyl-cpg-binding Protein 2; Chain A                                                                        CATH domains
               Pfam domains -------------------MBD-1ub1A01 A:91-165                                                       ------------------------------- Pfam domains
         Sec.struct. author ..................................eeeeee.........eeeeee.....ee.hhhhhhhhhh........hhh...hhhhh................................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ub1 A  72 APAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQRPPKKAKSPKSPGSGRGRGRPKGSG 196
                                    81        91       101       111       121       131       141       151       161       171       181       191     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (O42403_CHICK | O42403)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ub1)
 
  Sites
(no "Sites" information available for 1ub1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ub1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ub1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O42403_CHICK | O42403
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O42403_CHICK | O42403
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1UB1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UB1)