Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RHODANESE FROM THERMUS THERMOPHILUS HB8
 
Authors :  Y. Suzuki, Y. Kakuta, Riken Structural Genomics/Proteomics Initi (Rsgi)
Date :  17 Mar 03  (Deposition) - 21 Sep 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Rhodanese, Sulfurtransferase, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Suzuki, Y. Kakuta
Crystal Structure Of Rhodanese From Thermus Thermophilus Hb
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - RHODANESE
    ChainsA
    EC Number2.8.1.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1CSS1Mod. Amino AcidS-MERCAPTOCYSTEINE
2GOL2Ligand/IonGLYCEROL
3MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:14 , HIS A:18 , ASP A:21 , THR A:81 , ARG A:109 , GLU A:120 , HOH A:1924 , HOH A:1930 , HOH A:1944 , HOH A:2082BINDING SITE FOR RESIDUE GOL A 1901
2AC2SOFTWAREVAL A:8 , LYS A:106 , ASP A:107 , GLU A:121 , ARG A:123 , HOH A:1906 , HOH A:1914 , HOH A:1970BINDING SITE FOR RESIDUE GOL A 1902

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UAR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UAR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UAR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UAR)

(-) Exons   (0, 0)

(no "Exon" information available for 1UAR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:276
 aligned with Q5SJI0_THET8 | Q5SJI0 from UniProtKB/TrEMBL  Length:285

    Alignment length:284
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281    
         Q5SJI0_THET8     2 GYAHPEVLVSTDWVQEHLEDPKVRVLEVDEDILLYDTGHIPGAQKIDWQRDFWDPVVRDFISEEEFAKLMERLGISNDTTVVLYGDKNNWWAAYAFWFFKYNGHKDVRLMNGGRQKWVEEGRPLTTEVPSYPPGRYEVPYRDESIRAYRDDVLEHIIKVKEGKGALVDVRSPQEYRGELTHMPDYPQEGALRAGHIPGAKNIPWAKAVNPDGTFKSAEELRALYEPLGITKDKDIVVYCRIAERSSHSWFVLKYLLGYPHVKNYDGSWTEWGNLVGVPIAKGEE 285
               SCOP domains d1uara1 A:2-144 Sulfurtransferase                                                                                                              d1uara2 A:145-285 Sulfurtransferase                                                                                                           SCOP domains
               CATH domains 1uarA01 A:2-143 Oxidized Rhodanese, domain 1                                                                                                  1uarA02 A:144-285 Oxidized Rhodanese,         domain 1                                                                                         CATH domains
           Pfam domains (1) ----------------------------------------------------------------------------------------------------------------------------------------------------Rhodanese-1uarA01 A:150-275                                                                                                   ---------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------------------------------------------------------------------------------Rhodanese-1uarA02 A:150-275                                                                                                   ---------- Pfam domains (2)
         Sec.struct. author ...hhh.eehhhhhhh......eeeeee....hhhhhh.....eeehhhhhhh........hhhhhhhhhhhh......eeeee.hhhhhhhhhhhhhhhhh....eeee.hhhhhhhhhh....................hhh.eehhhhhhhhhhhhhh..eeeee..hhhhhh...--------............ee.hhhhhh.......hhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh......eeee.hhhhhhh............ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1uar A   2 GYAHPEVLVSTDWVQEHLEDPKVRVLEVDEDILLYDTGHIPGAQKIDWQRDFWDPVVRDFISEEEFAKLmERLGISNDTTVVLYGDKNNWWAAYAFWFFKYNGHKDVRLmNGGRQKWVEEGRPLTTEVPSYPPGRYEVPYRDESIRAYRDDVLEHIIKVKEGKGALVDVRSPQEYRGEL--------EGALRAGHIPGAKNIPWAKAVNPDGTFKSAEELRALYEPLGITKDKDIVVYcRIAERSSHSWFVLKYLLGYPHVKNYDGSWTEWGNLVGVPIAKGEE 285
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171        |-       191       201       211       221       231       241       251       261       271       281    
                                                                                                71-MSE                                 111-MSE                                                              180      189                                                240-CSS                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q5SJI0_THET8 | Q5SJI0)
molecular function
    GO:0004792    thiosulfate sulfurtransferase activity    Catalysis of the reaction: hydrogen cyanide + thiosulfate = H(+) + sulfite + thiocyanate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1uar)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1uar
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SJI0_THET8 | Q5SJI0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.8.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q5SJI0_THET8 | Q5SJI0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1UAR)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UAR)