1U6M - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF ACETYLTRANSFERASE

Authors :   T. Min, J. Gorman, L. Shapiro, S. K. Burley, New York Sgx Research Ce Structural Genomics (Nysgxrc)

Date :   30 Jul 04 (Deposition) - 14 Dec 04 (Release) - 21 Sep 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Acetyltransferase, Gnat Family, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Min, J. Gorman, L. Shapiro
The Crystal Structure Of Acetyltransferase, Gnat Family Fro Enterococcus Faecalis
To Be Published
PubMed: search

Molecule 1 - ACETYLTRANSFERASE, GNAT FAMILY
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21DE3
	Expression System Taxid	:	469008
	Organism Scientific	:	ENTEROCOCCUS FAECALIS
	Organism Taxid	:	1351

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 8)

No.	Name	Count	Type	Full Name
1	SO4	8	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 4 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG B:125 , GLY B:126 , ILE B:129 , GLY B:130 , HOH B:1011 , HOH B:1023 , HOH B:1084 , HOH B:1095	BINDING SITE FOR RESIDUE SO4 B 1001
2	AC2	SOFTWARE	HOH A:1093 , VAL C:120 , ARG C:125 , GLY C:126 , ILE C:129 , GLY C:130 , HOH C:1008 , HOH C:1010 , HOH C:1024 , HOH C:1047 , HOH C:1125	BINDING SITE FOR RESIDUE SO4 C 1002
3	AC3	SOFTWARE	ARG A:125 , GLY A:126 , ILE A:129 , GLY A:130 , HOH A:1011 , HOH A:1116	BINDING SITE FOR RESIDUE SO4 A 1003
4	AC4	SOFTWARE	LEU D:115 , ASN D:152 , HOH D:1021 , HOH D:1036 , HOH D:1060	BINDING SITE FOR RESIDUE SO4 D 1004
5	AC5	SOFTWARE	LEU A:115 , ASP A:116 , TYR A:164 , HOH A:1026 , HOH A:1055 , HOH A:1099	BINDING SITE FOR RESIDUE SO4 A 1005
6	AC6	SOFTWARE	LEU B:115 , ASP B:116 , THR B:117 , ASN B:152 , HOH B:1007 , HOH B:1045 , HOH B:1107 , HOH B:1133 , HOH B:1172	BINDING SITE FOR RESIDUE SO4 B 1006
7	AC7	SOFTWARE	LEU C:115 , ASP C:116 , LEU C:151 , ASN C:152 , HOH C:1022 , HOH C:1064 , HOH C:1123	BINDING SITE FOR RESIDUE SO4 C 1007
8	AC8	SOFTWARE	ARG D:125 , GLY D:126 , ILE D:129 , GLY D:130 , HOH D:1011 , HOH D:1013 , HOH D:1067 , HOH D:1084 , HOH D:1086	BINDING SITE FOR RESIDUE SO4 D 1008

(no "SS Bond" information available for 1U6M)

(no "Cis Peptide Bond" information available for 1U6M)

(no "SAP(SNP)/Variant" information available for 1U6M)

(no "PROSITE Motif" information available for 1U6M)

(no "Exon" information available for 1U6M)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:189
 aligned with Q836Z8_ENTFA | Q836Z8 from UniProtKB/TrEMBL  Length:187

    Alignment length:189
                             1                                                                                                                                                                                       187 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       | 
         Q836Z8_ENTFA     - -MIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEV-   -
               SCOP domains d1u6ma_ A: Putative acetyltransferase EF0945                                                                                                                                                  SCOP domains
               CATH domains 1u6mA00 A:2-190  [code=3.40.630.30, no name defined]                                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.hhhhhhhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhhhhh......hhh.eeeeee..eeeeeeeeee.hhh...hhhhhhhhhhh.................eeeeeeeee.hhhh..hhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhh...eeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u6m A   2 SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE 190
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181

Chain B from PDB  Type:PROTEIN  Length:189
 aligned with Q836Z8_ENTFA | Q836Z8 from UniProtKB/TrEMBL  Length:187

    Alignment length:189
                             1                                                                                                                                                                                       187 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       | 
         Q836Z8_ENTFA     - -MIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEV-   -
               SCOP domains d1u6mb_ B: Putative acetyltransferase EF0945                                                                                                                                                  SCOP domains
               CATH domains 1u6mB00 B:2-190  [code=3.40.630.30, no name defined]                                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.hhhhhhhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhhhh.......hhh.eeeeee..eeeeeeeeee.hhh...hhhhhhhhhh..................eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u6m B   2 SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE 190
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181

Chain C from PDB  Type:PROTEIN  Length:189
 aligned with Q836Z8_ENTFA | Q836Z8 from UniProtKB/TrEMBL  Length:187

    Alignment length:189
                             1                                                                                                                                                                                       187 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       | 
         Q836Z8_ENTFA     - -MIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEV-   -
               SCOP domains d1u6mc_ C: Putative acetyltransferase EF0945                                                                                                                                                  SCOP domains
               CATH domains 1u6mC00 C:2-190  [code=3.40.630.30, no name defined]                                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.hhhhhhhhhhhhhhhh....hhhhh..hhhhhhhhhhhhh.......hhh.eeeeee..eeeeeeeeee.hhhhh.hhhhhhhhhhh.................eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeeee....eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u6m C   2 SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE 190
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181

Chain D from PDB  Type:PROTEIN  Length:189
 aligned with Q836Z8_ENTFA | Q836Z8 from UniProtKB/TrEMBL  Length:187

    Alignment length:189
                             1                                                                                                                                                                                       187 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       | 
         Q836Z8_ENTFA     - -MIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEV-   -
               SCOP domains d1u6md_ D: Putative acetyltransferase EF0945                                                                                                                                                  SCOP domains
               CATH domains 1u6mD00 D:2-190  [code=3.40.630.30, no name defined]                                                                                                                                          CATH domains
           Pfam domains (1) ------------------------------------------------------------Acetyltransf_1-1u6mD01 D:62-170                                                                              -------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------Acetyltransf_1-1u6mD02 D:62-170                                                                              -------------------- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------Acetyltransf_1-1u6mD03 D:62-170                                                                              -------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------Acetyltransf_1-1u6mD04 D:62-170                                                                              -------------------- Pfam domains (4)
         Sec.struct. author ..eee.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhh.eeeeee..eeeeeeeeee.hhh...hhhhhhhhhh..................eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhh...eeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u6m D   2 SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE 190
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Acyl-CoA N-acyltransferases (Nat) (250)

Superfamily: Acyl-CoA N-acyltransferases (Nat) (250)

Family: N-acetyl transferase, NAT (154)

Protein domain: Putative acetyltransferase EF0945 (1)

Enterococcus faecalis [TaxId: 1351] (1)

1a	d1u6ma_	A:
1b	d1u6mb_	B:
1c	d1u6mc_	C:
1d	d1u6md_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Aminopeptidase (284)

Homologous Superfamily: [code=3.40.630.30, no name defined] (126)

Enterococcus faecalis. Organism_taxid: 1351. (2)

1a	1u6mA00	A:2-190
1b	1u6mB00	B:2-190
1c	1u6mC00	C:2-190
1d	1u6mD00	D:2-190

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Acetyltrans (109)

Family: Acetyltransf_1 (58)

Enterococcus faecalis (Streptococcus faecalis) (1)

1a	Acetyltransf_1-1u6mD01	D:62-170
1b	Acetyltransf_1-1u6mD02	D:62-170
1c	Acetyltransf_1-1u6mD03	D:62-170
1d	Acetyltransf_1-1u6mD04	D:62-170

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (Q836Z8_ENTFA | Q836Z8)

molecular function
	GO:0008080		N-acetyltransferase activity		Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
	GO:0016740		transferase activity		Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1u6m)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1u6m
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q836Z8_ENTFA \| Q836Z8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q836Z8_ENTFA \| Q836Z8
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1U6M)

(no "Related Entries Specified in the PDB File" available for 1U6M)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (2, 2)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File