1U4A - JenaLib

Title :   SOLUTION STRUCTURE OF HUMAN SUMO-3 C47S

Authors :   H. Ding, Y. Xu, H. Dai, Y. Tang, J. Wu, Y. Shi

Date :   23 Jul 04 (Deposition) - 08 Mar 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Beta Beta Alpha Beta Beta Alpha Beta Fold, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Ding, Y. Xu, Q. Chen, H. Dai, Y. Tang, J. Wu, Y. Shi
Solution Structure Of Human Sumo-3 C47S And Its Binding Surface For Ubc9
Biochemistry V. 44 2790 2005
PubMed-ID: 15723523 | Reference-DOI: 10.1021/BI0477586
(for further references see the PDB file header)

Compounds

Molecule 1 - UBIQUITIN-LIKE PROTEIN SMT3A
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET-22B(+)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	UBIQUITIN-LIKE DOMAIN
	Gene	:	SUMO3
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SMALL UBIQUITIN-LIKE MODIFIER PROTEIN 3
	Tissue	:	BRAIN

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (1, 1)

Exons (3, 3)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000332859	2a	ENSE00001315520	chr21:46238044-46237863	182	SUMO3_HUMAN	1-7	7	0	-	-
1.3a	ENST00000332859	3a	ENSE00001297766	chr21:46234019-46233891	129	SUMO3_HUMAN	8-50	43	1	A:14-50	37
1.4a	ENST00000332859	4a	ENSE00001653460	chr21:46229033-46228962	72	SUMO3_HUMAN	51-74	24	1	A:51-74	24
1.6b	ENST00000332859	6b	ENSE00001793847	chr21:46226955-46225532	1424	SUMO3_HUMAN	75-103	29	1	A:75-92	18

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:79
 aligned with SUMO3_HUMAN | P55854 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:79
                                    23        33        43        53        63        73        83         
           SUMO3_HUMAN   14 NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92
               SCOP domains d1u4aa1 A:14-92 Ubiquitin-like protein smt3a, SUMO-3                            SCOP domains
               CATH domains 1u4aA00 A:14-92                                                                 CATH domains
               Pfam domains ---Rad60-SLD-1u4aA01 A:17-87                                              ----- Pfam domains
         Sec.struct. author ...eeeeeee...eeeeeee....hhhhhhhhhhhhhh......eee....ee....hhhhhhh...eeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------S------------------------------------------------------ SAPs(SNPs)
                    PROSITE -UBIQUITIN_2  PDB: A:15-92 UniProt: 15-92                                       PROSITE
               Transcript 1 Exon 1.3a  PDB: A:14-50 UniProt: 8-50Exon 1.4a  PDB: A:51-74 Exon 1.6b          Transcript 1
                  1u4a A 14 NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92
                                    23        33        43        53        63        73        83

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (10, 10)

NMR Structure(hide GO term definitions)

Chain A (SUMO3_HUMAN | P55854)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0031386	protein tag	A molecular function exhibited by a protein that is covalently attached (AKA tagged or conjugated) to another protein where it acts as a marker, recognized by the cellular apparatus to target the tagged protein for some cellular process such as modification, sequestration, transport or degradation.
biological process
	GO:0070911	global genome nucleotide-excision repair	The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
	GO:0016925	protein sumoylation	The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
cellular component
	GO:0016605	PML body	A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0000776	kinetochore	A multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1u4a)

	Sites
(no "Sites" information available for 1u4a)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1u4a)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1u4a
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SUMO3_HUMAN \| P55854
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SUMO3_HUMAN \| P55854
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description