|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 3) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1U40) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1U40) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1U40) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:155 aligned with ISPF_ECOLI | P62617 from UniProtKB/Swiss-Prot Length:159 Alignment length:155 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 ISPF_ECOLI 1 MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI 155 SCOP domains d1u40a_ A: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF SCOP domains CATH domains 1u40A00 A:1-155 [code=3.30.1330.50, no name defined] CATH domains Pfam domains YgbB-1u40A01 A:1-155 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------ISPF --------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1u40 A 1 MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI 155 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (10, 10)|
Asymmetric Unit(hide GO term definitions) Chain A (ISPF_ECOLI | P62617)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|