Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  PURE (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE) FROM THE ACIDOPHILE ACETOBACTER ACETI
 
Authors :  E. C. Settembre, J. R. Chittuluru, C. P. Mill, T. J. Kappock, S. E. Ealick
Date :  14 Jul 04  (Deposition) - 28 Sep 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (4x)
Biol. Unit 2:  A,B  (8x)
Keywords :  Acidophile, Pure, Protein Stability, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. C. Settembre, J. R. Chittuluru, C. P. Mill, T. J. Kappock, S. E. Ealic
Acidophilic Adaptations In The Structure Of Acetobacter Aceti N5-Carboxyaminoimidazole Ribonucleotide Mutase (Pure)
Acta Crystallogr. , Sect. D V. 60 1753 2004
PubMed-ID: 15388921  |  Reference-DOI: 10.1107/S090744490401858X

(-) Compounds

Molecule 1 - PURE (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE)
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-23A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PURE
    Organism Scientific: ACETOBACTER ACETI
    Organism Taxid: 435

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (4x): AB
Biological Unit 2 (8x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1CIT8Ligand/IonCITRIC ACID
Biological Unit 2 (1, 16)
No.NameCountTypeFull Name
1CIT16Ligand/IonCITRIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:29 , SER A:30 , SER A:32 , ASP A:33 , SER A:57 , HIS A:59 , ALA A:84 , GLY A:85 , HOH A:564 , HOH A:688 , HOH A:691 , PRO B:125BINDING SITE FOR RESIDUE CIT A 1001
2AC2SOFTWAREPRO A:125 , GLY B:29 , SER B:30 , ASP B:33 , SER B:57 , HIS B:59 , ALA B:84 , GLY B:85 , ALA B:87 , HOH B:682 , HOH B:692BINDING SITE FOR RESIDUE CIT B 1002

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1U11)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1U11)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1U11)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1U11)

(-) Exons   (0, 0)

(no "Exon" information available for 1U11)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:159
 aligned with Q2QJL3_ACEAC | Q2QJL3 from UniProtKB/TrEMBL  Length:182

    Alignment length:159
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169         
         Q2QJL3_ACEAC    20 SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI 178
               SCOP domains d1u11a_ A: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)                                                                                      SCOP domains
               CATH domains 1u11A00 A:20-178  [code=3.40.50.7700, no name defined]                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhh......eeeeeee...hhhhhhhhhh...eeeeee......hhhhhhhhhh.......ee...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u11 A  20 SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI 178
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169         


Chain B from PDB  Type:PROTEIN  Length:163
 aligned with Q2QJL3_ACEAC | Q2QJL3 from UniProtKB/TrEMBL  Length:182

    Alignment length:163
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177   
         Q2QJL3_ACEAC    18 AASAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPITE 180
               SCOP domains d1u11b_ B: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)                                                                                          SCOP domains
               CATH domains 1u11B00 B:18-180  [code=3.40.50.7700, no name defined]                                                                                                              CATH domains
           Pfam domains (1) ----AIRC-1u11B01 B:22-173                                                                                                                                   ------- Pfam domains (1)
           Pfam domains (2) ----AIRC-1u11B02 B:22-173                                                                                                                                   ------- Pfam domains (2)
         Sec.struct. author ......eeeee.hhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhh......eeeeeee...hhhhhhhhhh...eeeeee......hhhhhhhhhh.......ee...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u11 B  18 AASAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPITE 180
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: AIRC] (12)
(-)
Family: AIRC (12)
(-)
Acetobacter aceti (1)
1aAIRC-1u11B01B:22-173
1bAIRC-1u11B02B:22-173

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q2QJL3_ACEAC | Q2QJL3)
molecular function
    GO:0034023    5-(carboxyamino)imidazole ribonucleotide mutase activity    Catalysis of the reaction: 5-carboxyamino-1-(5-phospho-D-ribosyl)imidazole = 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
biological process
    GO:0006189    'de novo' IMP biosynthetic process    The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
    GO:0006164    purine nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1u11)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1u11
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2QJL3_ACEAC | Q2QJL3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q2QJL3_ACEAC | Q2QJL3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q2QJL3_ACEAC | Q2QJL3: 2fw1 2fw6 2fw7 2fw8 2fw9 2fwa 2fwb 2fwi 2fwj 2fwp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1U11)